KEGG   Camelus ferus (Wild Bactrian camel): 102520456
Entry
102520456         CDS       T02979                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X1
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05206  MicroRNAs in cancer
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102520456 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102520456 (CDK6)
   04115 p53 signaling pathway
    102520456 (CDK6)
   04218 Cellular senescence
    102520456 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102520456 (CDK6)
   05206 MicroRNAs in cancer
    102520456 (CDK6)
   05203 Viral carcinogenesis
    102520456 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102520456 (CDK6)
   05225 Hepatocellular carcinoma
    102520456 (CDK6)
   05214 Glioma
    102520456 (CDK6)
   05220 Chronic myeloid leukemia
    102520456 (CDK6)
   05218 Melanoma
    102520456 (CDK6)
   05224 Breast cancer
    102520456 (CDK6)
   05222 Small cell lung cancer
    102520456 (CDK6)
   05223 Non-small cell lung cancer
    102520456 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102520456 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102520456 (CDK6)
   05164 Influenza A
    102520456 (CDK6)
   05162 Measles
    102520456 (CDK6)
   05163 Human cytomegalovirus infection
    102520456 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102520456 (CDK6)
   05169 Epstein-Barr virus infection
    102520456 (CDK6)
   05165 Human papillomavirus infection
    102520456 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102520456 (CDK6)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102520456 (CDK6)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102520456 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 102520456
NCBI-ProteinID: XP_032339889
LinkDB
Position
7
AA seq 363 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDCCCRQCC
YLCGEWGQGRRAVLHRAPHDVWPNCSALEACMLLVWTFWRLLLLCLAELQVFGLVVLSAG
GHFRCSHHQRWGAQWPGNPFCPLGFQSALNVLYSSQLVVHCSVLFSWAKGAMFHNPFFFG
TLK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgtgcggaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggctcgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgagtgcaaaccggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttc
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaacactagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtagtgcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacctccgtggtc
gtcacgctgtggtacagagctcccgaggtcttgcttcagtccagctacgccacccctgtg
gatctctggagtgtcggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtcgatcaactaggaaaaatcttggactgctgctgcagacagtgttgc
tatttgtgtggtgagtggggacagggtagacgtgctgttttgcacagagcccctcatgac
gtgtggcctaactgctctgctctggaagcttgtatgttgcttgtgtggaccttttggcgg
cttctccttctctgcttggctgagctccaggtctttggtttagttgtgttgtcagctggg
ggtcatttcagatgctcccaccatcagaggtggggtgctcagtggcccggtaacccattt
tgcccactaggcttccagtccgcattgaatgtcctttattcatcccagttggttgtacat
tgttctgttttgttttcctgggccaagggtgctatgttccacaatccatttttctttgga
acactgaaatag

KEGG   Camelus ferus (Wild Bactrian camel): 102522300
Entry
102522300         CDS       T02979                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr04530  Tight junction
cfr04660  T cell receptor signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102522300 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102522300 (CDK4)
   04115 p53 signaling pathway
    102522300 (CDK4)
   04218 Cellular senescence
    102522300 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102522300 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102522300 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102522300 (CDK4)
   05203 Viral carcinogenesis
    102522300 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102522300 (CDK4)
   05225 Hepatocellular carcinoma
    102522300 (CDK4)
   05214 Glioma
    102522300 (CDK4)
   05220 Chronic myeloid leukemia
    102522300 (CDK4)
   05218 Melanoma
    102522300 (CDK4)
   05219 Bladder cancer
    102522300 (CDK4)
   05224 Breast cancer
    102522300 (CDK4)
   05222 Small cell lung cancer
    102522300 (CDK4)
   05223 Non-small cell lung cancer
    102522300 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102522300 (CDK4)
   04934 Cushing syndrome
    102522300 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102522300 (CDK4)
   05160 Hepatitis C
    102522300 (CDK4)
   05164 Influenza A
    102522300 (CDK4)
   05162 Measles
    102522300 (CDK4)
   05163 Human cytomegalovirus infection
    102522300 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102522300 (CDK4)
   05169 Epstein-Barr virus infection
    102522300 (CDK4)
   05165 Human papillomavirus infection
    102522300 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102522300 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102522300 (CDK4)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102522300 (CDK4)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102522300 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 102522300
NCBI-ProteinID: XP_006182588
LinkDB
Position
12
AA seq 303 aa
MTTPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGSGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgactacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg
tacaaagcccgtgatccccacagtggccactttgtggccctcaagagcgttagagttccc
aatggaggaggctctggagggggcctgcccatcagcacagttcgtgaggtggccttactg
cggcgcctggaggcttttgagcatcccaatgttgtacggctgatggacgtctgtgccaca
gcccgaactgaccgggaaaccaaagtgaccctggtatttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg
atgcgccagttcctaagaggcctagatttccttcatgccaactgcattgttcaccgagac
ctgaagccagagaacattctggtgacgagtggtgggacagtcaagctggctgactttggc
ctggccaggatctacagctaccagatggcacttacacctgtggtggttacactctggtac
cgtgctccggaagttcttctgcagtctacgtatgcaacacctgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctgttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagaggaccgcgcccagtgcagtcagtg
gttcctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system