KEGG   Camelus ferus (Wild Bactrian camel): 102521467
Entry
102521467         CDS       T02979                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04022  cGMP-PKG signaling pathway
cfr04141  Protein processing in endoplasmic reticulum
cfr04151  PI3K-Akt signaling pathway
cfr04211  Longevity regulating pathway
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04668  TNF signaling pathway
cfr04728  Dopaminergic synapse
cfr04911  Insulin secretion
cfr04915  Estrogen signaling pathway
cfr04918  Thyroid hormone synthesis
cfr04925  Aldosterone synthesis and secretion
cfr04926  Relaxin signaling pathway
cfr04927  Cortisol synthesis and secretion
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04934  Cushing syndrome
cfr04935  Growth hormone synthesis, secretion and action
cfr05020  Prion disease
cfr05030  Cocaine addiction
cfr05031  Amphetamine addiction
cfr05034  Alcoholism
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102521467 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102521467 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102521467 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102521467 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102521467 (ATF6B)
   04915 Estrogen signaling pathway
    102521467 (ATF6B)
   04926 Relaxin signaling pathway
    102521467 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102521467 (ATF6B)
   04918 Thyroid hormone synthesis
    102521467 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102521467 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102521467 (ATF6B)
   04927 Cortisol synthesis and secretion
    102521467 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102521467 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102521467 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102521467 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102521467 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102521467 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102521467 (ATF6B)
   05031 Amphetamine addiction
    102521467 (ATF6B)
   05034 Alcoholism
    102521467 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102521467 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102521467 (ATF6B)
   05161 Hepatitis B
    102521467 (ATF6B)
   05163 Human cytomegalovirus infection
    102521467 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102521467 (ATF6B)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102521467 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 ZapB YabA Docking
Other DBs
NCBI-GeneID: 102521467
NCBI-ProteinID: XP_006178864
LinkDB
Position
20
AA seq 708 aa
MVGGRGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTQLFRCLEQD
VPFGSSPLDLGMDISPPEPPWDPLPISPDLQVKSEPSSPCSSSSLSSESSHLSTEPSTQA
SGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTADDPSDVQIKIEPVSPSSSIN
SEASLLSAESSSQAFIGEEVLEVKTESPSPQGCLLRDVAGAPLGAVQISVGPSSDGSSGK
ALPARKPPLQPKPVVITAVPMPPRAVPPSTAVLLQPLVQPPPVSPVLLIQGAIRVQPEGP
NPPAPRPERKSIVPAPMPGNSCPPEVDVKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVS
ISEPPPAPISPRMSREEPRPRRHLLGFSAQEPVHGAEPPQRPSQGPEEPQSSPAGQPSFR
NLTAFPGGARELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKVPPRAQ
ERQKSQLWKKSPPFKAVPTQPLGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSSTPGNATGGPLPASASSQAPPAAHQPLYLNHP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggttggggggcgggggggaaagatggcggagctgatgcttctcagcgagattgcggat
ccgacgcgttttttcaccgataatttgctgagcccggaggactgggacagcaccttgtac
gccggcctggatgaagtggccgaggagcagacgcagctcttccgttgcctggagcaggat
gtcccgtttggcagcagccccctggacttggggatggatatcagccctcccgaacccccc
tgggaccctctgcctatctctccagatcttcaggtgaagtctgagccatcctctccctgc
tcttcctcctccctcagctctgaatcatcacatctttccacagagccctccacccaggcc
tctggtgtaggggaggtgctggttgtgaagacagagtccttggcacccccactctgcctc
ctgggagatgatccaacatccccatttgaaactgtccagatcaatgtgggccccaccgcc
gatgatccctcagatgtccagattaagatagaacctgtctctccatcttcctccatcaac
tctgaggcgtccctgctctctgcagagtcctccagccaggcttttataggagaggaggta
ctggaagtgaagacagagtccccatcccctcaaggctgtctcctgcgggatgtcgcaggc
gccccacttggtgccgttcagatcagcgtgggcccatcctccgatggctcctcaggcaaa
gccctgcccgcccggaagccaccgctgcagcccaaacctgtggtgataactgctgtcccg
atgccacccagagctgtgcctcccagcaccgctgtccttctgcagcccctcgtccagcca
cccccagtgtcgccagtcctcctcatccaaggtgctattcgagtccagcctgagggaccg
aacccccctgctccaagacctgagaggaagagcattgttccagctcctatgccagggaac
tcctgcccacctgaggtggatgtgaagctgctgaagcggcagcagcgaatgatcaagaac
cgggagtcagcctgccagtcccggaggaagaagaaagagtacctgcaggggctggaagcg
aggctgcaggccgtgctggccgacaaccagcagctccggcgggagaatgctgccctccgc
cggcggctggaggccctgctggctgagaacagcgagctcaagttagggtccggaaacagg
aaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtcagc
atcagtgagcctcctccagctcccatctctcctcggatgagcagagaggagcctcgaccc
cggagacacttgctggggttctcggcccaagagcctgttcatggagctgagcccccgcag
cgtccttctcagggccccgaggagccccagtccagccctgcaggccagccaagcttcagg
aacctgacggccttccccgggggcgccagggagctgctgctgagagacctggaccagctc
ttcctctcctctgattgccggcacttcaaccgaactgagtccctgaggcttgctgatgag
ctcagtggctgggtccagcgccaccagagaggccggcggaaggtccctccgagggcccag
gagaggcagaagtctcagctatggaagaagtcacctccatttaaggcagtccccacccag
ccccttgggcccccagaaagggattctgtgggccagctgcagctatatcgccacccagac
cgttcgcagccagagttcctggatgcaatcgaccgacgggaggacacattttatgttgtc
tccttccgaagggaccacctgctgctcccagccatcagccacaacaagacctctcggccc
aagatgtccctggtgatgcccgccatggcccccaatgagaccctgtcaggccgggggccc
ccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacccgggtgatt
cacatcaagacctccacagtgcccccctcgctccgaaaacagccgtcctccaccccgggc
aatgccacaggcggccccttgccagcttctgcatccagccaggcccccccggctgcccat
cagcccctctacctcaatcatccctga

DBGET integrated database retrieval system