KEGG   Camelus ferus (Wild Bactrian camel): 102521743Help
Entry
102521743         CDS       T02979                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04217  Necroptosis
cfr04218  Cellular senescence
cfr04380  Osteoclast differentiation
cfr04640  Hematopoietic cell lineage
cfr04932  Non-alcoholic fatty liver disease (NAFLD)
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04940  Type I diabetes mellitus
cfr05020  Prion diseases
cfr05133  Pertussis
cfr05140  Leishmaniasis
cfr05152  Tuberculosis
cfr05162  Measles
cfr05164  Influenza A
cfr05321  Inflammatory bowel disease (IBD)
cfr05323  Rheumatoid arthritis
cfr05332  Graft-versus-host disease
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102521743 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102521743 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102521743 (IL1A)
   04218 Cellular senescence
    102521743 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102521743 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102521743 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102521743 (IL1A)
   05321 Inflammatory bowel disease (IBD)
    102521743 (IL1A)
   05332 Graft-versus-host disease
    102521743 (IL1A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    102521743 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102521743 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102521743 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102521743 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102521743 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102521743 (IL1A)
   05152 Tuberculosis
    102521743 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    102521743 (IL1A)
   05164 Influenza A
    102521743 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102521743 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102521743 (IL1A)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Interleukins
   102521743 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1_propep IL1
Motif
Other DBs
NCBI-GeneID: 102521743
NCBI-ProteinID: XP_014413782
LinkDB All DBs
Position
Un
AA seq 273 aa AA seqDB search
MQKMAKVPDLFEDLKNCYSENEEYGSEIDHLSLNQKSFYDASYEPLQEDCMDKLMSLSTS
ETSKTSKLTFKESVVMVASNGKILKKRRLSLNQFITNDDLEAIANDTEEEIIKPRSVPYN
LQSNVKYNYMRIVNHQCILNDALNRSIIRDPSGQYLMAAVLNNLDDAVKFDMGAYTSEED
SQLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTITDETNLLFFWEKHGSKDYFKSAA
HPKLFIATKQEELVHMAKGLPSITDFQILENQS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagatggccaaagtccccgacctctttgaagacctgaagaactgttacagtgaa
aatgaagaatacggttctgaaattgaccatctctctctgaatcagaagtccttctatgat
gcaagctatgagccacttcaagaggactgcatggacaaactgatgtctctgagtacctct
gaaacctctaagacatccaagcttaccttcaaggagagtgtggtgatggtggcaagcaat
ggaaagattctgaagaagagacggctgagcttaaatcagttcatcaccaatgatgaccta
gaagccattgccaatgacacagaagaagaaattatcaagcccagatcagtaccttacaac
ctgcagagcaacgtgaaatacaactatatgaggatcgtcaaccaccagtgcatcctgaat
gacgccctcaatcgaagtataattcgagacccgtcaggtcaatacctcatggctgccgtg
ttaaacaacctggacgacgcagtgaaatttgacatgggtgcttatacatcagaagaggat
tctcaacttcctgtgactctaagaatctcaaaaacacggctgtttgtgagtgctcaaaat
gaagacgaacctgtgttgctgaaggagatgcctgagacacccaaaaccatcacagatgag
accaatctcctcttcttctgggaaaagcatggcagtaaggactacttcaaatcagctgcc
catccaaaattgtttattgccacaaagcaagaagaactagtgcacatggcaaaggggctg
ccctcgatcaccgactttcagatactggaaaaccagtcttga

DBGET integrated database retrieval system