KEGG   Camelus ferus (Wild Bactrian camel): 102522322Help
Entry
102522322         CDS       T02979                                 

Gene name
HSPG2
Definition
(RefSeq) heparan sulfate proteoglycan 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04512  ECM-receptor interaction
cfr05161  Hepatitis B
cfr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102522322 (HSPG2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102522322 (HSPG2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102522322 (HSPG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF Ig_6 C2-set_2 Ldl_recept_a Izumo-Ig EGF Laminin_G_3 hEGF SEA
Motif
Other DBs
NCBI-GeneID: 102522322
NCBI-ProteinID: XP_014417706
LinkDB All DBs
Position
Un
AA seq 4422 aa AA seqDB search
PQVTHGLRAYDGLSLPEDAETITAGRAGWSYSDLSDDEDFLADEASGDGVGSGDLGSGDF
QMGPGPPLGRPPGAGVMVSEPDEESPLIYFRALVNFTRSIDYSPQLEDASSEEFREVSEA
VVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEVLHTVISSGSI
ASYITSPQGFQFRRLGTAQTPPPPLAAVAAAATPVPQVSRACTEAEFACHRYNECVALEY
RCDRRPDCRDMSDELDCEEPVPALSSLPPRLVETPPLPPQPEATTTQLLPATPAPQALFP
GPDRPVPCGPHEATCHSGHCIPKDYVCDGQEDCKDGSDELDCGEGWAGVQVGSGGSAGYP
HHLVLSSAAKRPEDVCGPTQFRCVSTNACIPASFHCDEESDCPDRSDEFGCMPPQVVTPP
QESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRITMTSEGGRGTLTIRDVKEA
DQGAYTCEAMNARGMVFGIPDGVLELIPQRGPCPDGHFYLEHSASCLPCFCFGITNVCQS
SRRFRDQIHLRFDQPNDFKGVNVTMPSQPGTQPLSSTQLLIDTALQEFQLVDLSRRFLVH
DSFWTLPEQFLGNKVDSYGGFLRYKVRYELARGMLEPVQRPDVVLVGAGYRLLSRGHTPT
QPGAVNQRQVQFSEEHWVHESGQPVQRAEMLQVLQSLEAMLIQTVYNTKMANVGLSDISM
DTTVTYATSHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASS
CDPVYGHCLNCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLD
TDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTNQQIVRCDERGSTGASGEAC
RCKNNVVGRLCNECVAGSFHLSAHNPDGCLKCFCMGVSRQCTSSSWSRSQVLGASEEPAQ
FSLTNAAGTHTTSEGISSPRPGELAFSSFHSLLSGPYFWNLPSRFLGDKVTSYGGELRFT
VTQQPQPGSAPLHGQPLVVLQGNNIVLEHHTSQEPSPGQPSTFTVPFREQAWQRPDGQPA
TREHLLMALAGIDTLLIQASYTQRPAESRVSGISMDVAVPEDTGQDPALEVEQCTCPPGY
RGPSCQDCDTGYTRMPSGLYLGTCERCSCHGHTEVCEPETGSCQGCQHHTEGPRCEQCQP
GYYGDAQRGTPQDCQPCPCHGAPASGQATHTCFLDTDGHPTCDACSPGHSGRHCERCAPG
YYGNPSQGQPCRRDGQLPEPADCGCDPQGSVSNQCDAAGQCQCKAQVEGLTCDSCRPHHF
HLSASNPDGCLPCFCMGITQQCSSSSYTRHLISTRFAPGDFQGFALVNPQRNSRLTGGFT
VEPVPEGAQLSFGNFAQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGAQGSPLSD
PDIQITGNNIMLVASQPALQGPERKSYEIIFQEEFWRRPDGQPATREHLLMALADLDELL
VRATFSSMPLAASISAVSLEVAQPGPSEGPRALEVEECRCPPGYVGSSCQDCAPGYTRTG
SGLYLGHCELCECNGHSDLCHPETGSCSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQP
CACPLTNPENMFSRTCESLGASGYRCTACEPGYTGQYCEQCAPGYVGNPNVRGGRCLPQD
QAPLVVQVQPTRSIVPQGGPHSLRCQVSGSPPHYFYWSREDGRPLPSSTQQRHQGSELHF
PSVQPSDAGVYICTCRNLHHANTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFIC
TAKSKSPAYTLVWTRLHNGKLPARAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTA
TLHVQASGTPSAPMASIHPPQLTVQPGQVAEFRCSATGNPTPTLEWTGGPGGQLPQKAQI
HGGILRLPAVEPADQAQYLCRAVSSSGQHVARAVLHVHGGSGPRVQVSPERTQVHEGRTV
RLYCRAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITPADAGFYLCVATSPAGT
AQARIQVVVLPASGASSPPVRIESSAPSVTEGQTLDLNCVVTGLAHTQVTWYKRGGSLPP
HAQVHGSRLRLPHVSPADSGEYVCRVENESGPKEASIIVSVLHSTHSGPSYTPAPGSTQP
VRIESSSSHVAEGQTLDLNCVVPAQAHAHVTWYRRGGSLPARHQTHGSLLRLHQVSPADS
GEYVCRVVLGSGPLETSVLVTIEASDSSTGSIPAPGPVPPVRIESSSPTVAEGQTLDLSC
VVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGEYVCRASNGVEASITVTVT
RTQGANFAYPPGGTQAIRIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPTRHQ
THGSLLRLYQVSPADSGEYVCRVVGGSVPLEASVLVTIEPADSVPALGVTPPVRIESSSS
HVAEGQTLDLNCLVSGQAHAQVTWHRRGGSLPARHQVHGSRLRLPQMTPADSGEYVCRVV
SSSGTQEASVLVTIQQHLGPTRFQNVVYPVRIESSSASLANGHTLDLNCLVASQAPHTIT
WYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIQGSGSSHVP
SISPPIRIESSSPTVVEGQTLDLNCVVAGQPQATITWYKRGGSLPTRHQAHGSRLRLNQM
SVADSGEYVCRANNNIDAQEASIMISVSPSASSPSVPGGALPIRIESSSSHVAEGQTLDL
NCVVPGQAHAQVTWHKRGGSLPTHHQAHGSRLRLHRLSPADSGEYVCRVVSSSGQLEASV
LVTIEASSSGAVLIPAPGGTPPIRIETSSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGS
LPARHQVHGSLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEASSPGPIPAPGLAQP
VYIEASSSHVSEGQTLDLNCVVPGQAHAQVTWYKRGGNLPTRHQTHGSRLRLHHVSQADS
GEYVCRVVGSSGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIH
DGAAPISLDWKTRNQELEDNVHISPNGSIITIVGTRPSNHGAYRCVASNAYGVAQSVVNL
SVHGPPTVSVLPEGPVRVKVGKSVALECVSAGEPRSSARWTRTGTPTHLEQRAYGHLDSH
TVLQISSAKPSDAGTYVCLAQNALGTAQKRVEVIVDTGIVAPGAPQVQVEEAELTVEAGH
TATLRCSATGSPTPTIHWSKLRSPLPWQHQLEGDTLIIPRVAQQDSGQYICNATSPVGHA
EATIALHVESPPYATTVPEHASVRAGETVQLQCLAHGTPPLTFQWSRVGGSLPGRATARN
ELLLFESAAPEDSGRYRCQVTNKVGSAEAFAQVLVQGPSGSLPATPIPAGSTPIPAGSTP
TIQVTPQLETKSIGASVEFHCVVPSDQGTQLRWFKEGGQLPPGHSVHDGVLRIQNLDQSC
QGTYVCQAHGPWGQAQASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQV
TWSKVGGRLRPGIVQSGGVVRIAHVELADAGQYRCTATNTAGTTQSHVLLLVQALPQIST
PPEVRVPAGSAAVFPCMASGYPTPDITWTKLDGNLPPDSRLEDNMLLLPSVRPQDAGTYV
CTATNRQGKVKAFAHLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIKITFRPDSADGL
LLYSGMLLYNGQKQIPGTPTNLASRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLAL
GQFHTVTLLRSLTQGSLIVGSLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSS
GFVGCVRELRIQGEEIIFHDLNLTAHGISHCPTCRDRPCQNGGLCQDSESSSYVCICPAG
FTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTSQLYTCRCHLGRSGMRCEEGVTVTT
PSMSGTGSYLALPALTNTHHELRLDVEFKPLVPDGILLFSGGPRGPVEDFVSLAMVGSHL
EFRYELGSGLAILRSSEPLALGRWHRVSAERLNKDGSLRVNSGRPVLRSSPGKSQGLNLN
TLLYLGGVEPSVQLPPATNVSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCE
RQPCQNGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQGTRCLCPPG
FSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFYDNGFLVLPGRIFSRSLPEVPET
IELEVRTSTASGLLLWQGVEVGESGRGKDFIGLGLQDGHLVFSYQLGSGEARLVSEDPIN
DGEWHRVTALREGRRGSIQLDGEELVSGQSPGPNVAVNTKGSIYIGGAADVAALTGGRFS
SGITGCIKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS
NT seq 13269 nt NT seq  +upstreamnt  +downstreamnt
ccacaggtgacccatgggctgagggcgtacgatggcttgtccctgcctgaggatgcagag
acaatcacagctggccgggctggctggagttattcagacctttctgatgatgaggacttc
ctggctgacgaggcctctggagatggcgtgggcagtggggacctgggcagtggggacttc
cagatgggccctgggccacccctgggccgccctcctggggctggtgtgatggtctcggaa
cctgatgaggagtctcctctcatttatttccgagccctggtaaatttcactcgctccatc
gactacagccctcagctagaggatgccagctccgaggagttccgagaggtgtccgaggct
gtggtagacacgctggagtcagagtacttgaagattcctggagaccaggttgtcagtgtg
gtgttcatcaaggagctggatggctgggtctttgtggagctggatgtgggctccgaaggg
aatgcggacggggctcagattcaggaggtgctgcacacggtcatttccagcggctccatt
gcctcctacatcacctctccccagggatttcagttccggcgcctgggcacagcacagaca
cccccgccccccttggccgccgtggcggctgcagcgacaccagtgcctcaggtctcaagg
gcctgcaccgaggccgagttcgcctgccaccgctacaatgagtgtgtggccctggagtat
cgctgtgaccggaggcctgactgcagggacatgtctgatgagctcgattgtgaggagcca
gtcccagcgctcagctccctgccaccccgtctggtggagacaccacctttaccgccccag
ccggaggcaaccaccacacagctgctaccagccacccctgctccccaggctctgttccct
ggtccagacaggcctgtgccctgtgggccccacgaggccacatgccacagtgggcactgc
atccccaaagactacgtctgtgatgggcaggaggactgcaaggacggcagtgatgagctg
gactgcggtgagggctgggcaggggtgcaggtgggcagtgggggcagtgccggctaccca
caccacctggttctgtcctcagccgccaagcgccccgaggacgtgtgcgggcccacgcag
ttccgctgtgtctccacaaatgcgtgcatcccggccagcttccactgtgacgaggagagc
gactgtcccgaccgcagcgacgagtttggctgcatgcctccccaggtggtgacccctccc
caggagtcgatccaggcttcccggggccaaacggtgaccttcacctgtgtggccatcggc
gtccccacccctatcatcaactggaggctcaactggggccacatcccctctcatcccagg
ataacaatgaccagtgagggaggccgtggcacgctgaccattcgcgatgtgaaggaggca
gaccagggtgcgtacacctgtgaggccatgaacgcccgaggcatggtgtttggcattccc
gacggtgtcctggagctcatcccacagcgaggaccctgccccgatgggcacttctacctg
gagcacagcgcctcctgcctgccctgcttctgctttggcatcaccaacgtgtgccagagc
agccgccgcttccgagaccagatccatctgcgctttgaccagcccaatgacttcaagggt
gtgaacgtgacaatgccctcacagcctggcacgcagcccctctcctccacccagctgctg
atcgacactgctctgcaggagttccagctggtcgacctgtcccgacgcttcctggtccat
gactctttctggactctgcctgagcagttcctaggcaacaaggtggattcctacggtggc
ttcctgcgctacaaggtgcgctatgagctggcacgtggcatgctggagccagtgcagcgg
ccagatgtggtccttgtgggtgctggatatcgcctgctctcccgcggccacactcccacc
cagccgggtgctgtgaaccagcgccaggtccagttctctgaggagcactgggtgcatgag
tctggccagcccgtgcagcgggcggagatgctgcaggtgctgcagagcctggaggccatg
ctcatccagacggtgtacaacaccaagatggcaaacgtggggctgagtgacatctccatg
gacaccaccgtcacctatgccaccagccacggccgtgcccacagcgtagaggagtgcaga
tgccccattggctattctggcttgtcctgtgagagctgtgatgcccacttcacccgggtg
cctggtgggccctacctgggcacctgctctggctgcaactgcaatggccatgccagctcc
tgtgaccctgtatatggccactgcctgaactgccagcacaacacggaggggccacagtgc
aacaaatgcaaggccggcttctttggcgacgccacaaaggccacggccactgcctgccga
ccctgcccttgcccatacattgatgcctcccgcagattctcagacacctgcttcctggac
acagatggccaagccacgtgtgatgcatgtgccccaggctacacaggccgccgctgtgag
agctgtgcccccggatatgagggcaaccccatccagccaggcgggaagtgtaggcccacc
aaccagcagatcgtgcgttgtgatgagcgaggcagtacaggggcctctggggaggcctgc
cgctgtaagaacaatgtggtgggacgcctgtgcaatgagtgtgtcgccggctctttccac
ctgagtgcccacaaccccgacggctgcctcaagtgcttctgcatgggcgtcagtcgccag
tgcaccagctcctcctggagccgctcccaggtgcttggggcctctgaggagcctgctcag
ttcagcctgaccaacgccgcgggcacccacaccaccagcgagggcatctcgtcacccagg
cccggggaactggccttctcctccttccacagcctcctgtctggaccctacttctggaac
ctcccttctcgcttcctgggggacaaggtgacctcctacggaggagagctgcgcttcaca
gtaacccagcagccccagcctggctccgcgcccctgcacgggcagccattggtggtactg
cagggcaataacatcgtcttggagcatcacacctcccaggaacctagccccggccagccc
agcaccttcactgtgcccttccgagagcaagcatggcagcggcctgatgggcagccggcc
acacgggagcacctgctgatggcactggcgggcattgacaccctcctgatccaggcatcc
tacacccagcggccagctgagagcagggtctctggcatcagcatggatgtggctgtaccc
gaggacaccggccaggaccctgcactggaagtggagcagtgtacctgcccacctgggtac
cgtggcccatcctgccaggactgtgacacaggctacacacgcatgcccagtggcctctac
ctgggcacctgtgaacgctgcagctgccatggccacacggaggtctgtgagcctgaaaca
ggttcctgccagggctgccagcaccacacagagggtcctcggtgtgagcagtgccagccg
ggatactacggggatgcccagcgtgggacaccgcaggactgccagccatgcccatgccac
ggagccccggcctctggccaggccacccacacttgctttctggacacagacggacacccc
acctgtgatgcgtgttccccaggccacagtgggcggcactgtgagaggtgtgctccaggt
tactatggcaaccccagccagggccagccttgtcgaagagacggccaactgccagagccg
gctgactgtggctgtgaccctcagggcagtgtcagcaaccagtgtgatgccgctggacag
tgccagtgcaaggcccaggtggaaggcctcacctgcgacagttgccggccccaccacttc
cacctgagcgctagcaacccggacggctgcctgccctgcttctgcatgggcatcacccag
cagtgctccagctcctcctacactcgccacctgatctccacgcgctttgcccccggggac
ttccaaggcttcgccctggtgaacccgcagcgtaacagccgcctgacaggaggcttcact
gtggaacctgtgcccgagggcgcccagctttcttttggcaactttgcccaacttggccat
gagtccttctactggcagctgccggaaacataccagggagacaaggtggcggcctatggt
gggaagctgcgctacactctctcctacacggcgggggcccagggcagcccgctctctgac
cctgacatccagatcacgggcaacaacatcatgctggtggcctctcagccagcactgcag
ggcccggagaggaagagctatgagatcattttccaagaggaattctggcgccgtcctgac
gggcagccagccacgcgtgagcacctcctgatggcgctggccgacctggatgagctcctg
gtccgggccacattctcctcgatgccactagcggccagcatcagcgcagtcagcctggag
gtcgcccagcctgggccctcagagggaccccgggcccttgaggtggaggaatgccgctgc
cctccgggctacgtcggctcatcctgccaggactgtgcccccggctacacacgcactggg
agtggactctaccttggccactgtgagctgtgtgaatgcaatggccactcagacctgtgc
cacccagagactggatcctgctcgcaatgccagcacaacgccgctggggagttctgcgag
ctgtgtgcacctggctactatggagatgccacagctggaacacctgaagactgccagccc
tgtgcctgcccactgaccaacccagagaacatgttctcccgcacctgtgaaagcctggga
gctagtgggtaccgctgcacagcctgcgaacctggctacactggccagtattgtgagcag
tgtgctccaggatacgtgggtaaccccaatgtgcgagggggccggtgcctgccacaggac
caagccccgctggtggtccaggtccaaccaactaggagcatagtacctcaaggtggtccc
cactccctgcggtgccaggtcagtgggagcccaccccactacttctactggtctcgtgaa
gatgggcggcccttgcccagcagcacccagcagcgacatcaaggctccgagctccacttc
cccagcgtccagccctcagatgctggagtctatatttgcacctgtcgtaatctccatcat
gccaacaccagcagggcggagttgctggtcactgaggctccaagcaagcccatcacggtg
acagtggaggagcagcggagccagagcgtgcgccctggagccgacgtcaccttcatctgc
actgccaagagcaagtctccagcttacaccctcgtgtggacccgcctgcataatgggaaa
cttccagcccgagccatggatttcaatggaatcctgaccattcgcaatgtacagccaagt
gatgcaggcacctacgtgtgcaccggctccaacatgttcgccatggaccagggcactgcc
acgctgcatgtgcaagcctcaggcacaccatctgcccccatggcctccatccacccgccc
cagctcacagtgcagcctgggcaggtggctgagttccgctgcagtgccacggggaacccc
acgcccaccctcgaatggacagggggccctggtggccagctccctcagaaggcacaaatc
cacggtggtatcctgcgcctgccagccgttgagcccgcggatcaagcccagtacctgtgc
cgcgccgtcagcagctccgggcagcacgtggccagggcggtgctccacgtgcacgggggc
agcggacctcgggtccaagtgagtccagagaggacccaggtacatgaaggccgcactgtt
aggctgtactgcagggctgcaggtgtgcccagtgccaccatcacctggaggaaggaagga
ggcagcctccccccacaggcccggtctgagcgcacagacatcgccacactgctcatccca
gccatcacacccgccgacgctggcttctacctctgcgtggccaccagccccgcaggcacc
gcacaggcccggatccaagtggtcgtccttccagcctcaggtgccagctccccgccagtc
aggattgagtcctcagcaccttctgtgaccgaagggcagacactggacctcaactgcgtg
gtgacagggctggcccacacccaggtcacgtggtacaaacgagggggcagcctgcctcct
catgcccaggtgcacggctcccggctgcggctgccccacgtttcaccagctgattctgga
gaatacgtgtgccgagtggagaatgagtcaggccccaaggaggcctccatcatcgtctct
gtcctccacagcacccattcaggacccagctataccccagctccgggcagtacccagccc
gtccgcatcgagtcctcctcatctcacgtggccgaagggcagacgctggatctgaactgt
gtagtgcccgcgcaggcccacgcccatgtcacgtggtacaggcgtgggggcagcctcccc
gcccggcaccagacccacggctcactgctgcggctgcaccaagtgtccccagccgactca
ggcgagtatgtgtgccgtgtagtccttggctctgggcccctcgagacctccgtcctagtc
accatcgaggcctccgactccagcactggctccatccctgccccaggacctgtcccacct
gtcaggattgagtcctcatccccgacagtggcagaagggcagaccctggatctgagctgc
gtggtggcagggcaggcccatgcccaggtcacgtggtacaaacgtggaggcagcctccct
gcccggcaccaggtccgcggctcccgcctgtacatcttccaggcctcaccagctgatgct
ggcgagtatgtttgccgggccagcaatggtgtggaggcttccatcacagtcacagtaacc
aggacccagggagccaacttcgcctaccctcctggtggcacccaggccatccgcattgag
ccctcctcctcccacgtggccgaagggcagactctggatctgaattgcgtggtgcccggg
caggcccatgcccaggtcacatggcacaagcgtgggggcagcctccccacccggcaccag
actcacggctcactgctgagactctaccaggtgtccccagccgactcgggcgagtatgtg
tgccgcgtggtgggtggttccgtgcccctggaagcctctgtcctggtcaccattgagcct
gcagactctgtgcctgcactgggggttacccccccagtccggatcgagtcgtcatcctca
cacgtggctgaagggcagaccctggatctgaactgcctggtttctgggcaggcccacgcc
caggtcacgtggcacaggcgtgggggcagcctccctgcccgccatcaggtgcatggctca
aggctgcggctgccccagatgactccagctgactctggggagtacgtgtgccgcgtggtc
agcagctcaggcacccaggaagcctccgtccttgtcaccattcagcagcacctcggcccc
actcgcttccagaatgtcgtgtaccccgtccgcatcgagtcctcctcagcctccctggcc
aatggacataccctggacctcaactgcctggtggccagtcaagccccccacaccatcact
tggtataaacgtggaggcagcctacccagccggcaccagatcgtgggctcccggctacgg
atcccccaggtgacacccgcagactcgggcgaatacgtgtgtcatgtcagtaatggtgcc
ggctcccaggagacctcactgattgtcaccatccagggcagtggctcatcccacgtgccc
agcatctccccaccaatcaggatcgagtcctcatcccccacagtggttgaagggcagacc
ttggatctgaactgtgtagtcgctgggcagccccaggccaccatcacatggtacaagcgt
gggggcagccttcccactcgacaccaggcccacggctcccgcctgcggctgaaccagatg
tccgtggcagactccggcgaatacgtctgccgggctaacaacaacatcgatgcccaggaa
gcctccatcatgatctcagtctcccccagtgccagcagcccctctgtccctggcggggct
ttgcccatcagaattgagtcgtcatcttcacatgtggctgaagggcaaaccctggatctg
aactgcgtggtgcctggccaggcccatgcccaggtcacgtggcacaagcgtgggggcagc
ctccccactcaccaccaggcccacggctcacggctgcggctgcaccggttgtccccggct
gactcgggcgagtatgtgtgccgcgtggtgagcagctctggccagctggaggcctcagtc
ctggtcaccatcgaggcttctagctctggtgctgttctcatccctgccccaggcggaacc
ccacccatccgcatcgagacctcctcctcccacgtggcggaagggcagaccctggatctg
aactgcgtggtgcctggccaggcccacgcccaggtcacatggcacaggcgcgggggcagc
ctcccagcccggcatcaggtccatggctccctgctgaggctgaaccaagtgtccccggcc
gactctggcgagtactcgtgccaagtgactggcagctcaggcaccctggaggcttctgtc
ctggtcaccatcgaggcctccagcccaggccccattcctgccccaggactggcccagcct
gtctacattgaggcttcctcctcccacgtgtctgaagggcagaccctggacctgaactgt
gtggtacctgggcaagcccacgcccaggtcacatggtacaagcgcgggggaaacctcccc
acccggcaccagacccacggctccaggctgcggctgcaccatgtctctcaagccgactct
ggagaatatgtgtgccgcgtggttggcagctcaggccctgagcaggaggcctccttcacg
gtcactgtcccacccagtgaggggtcctcctaccgccttaggagccctgtcatctctatc
gacccgcccagcagtaccgtgcagcagggccaagatgccagcttcaagtgcctcatccat
gacggggcagcccccatcagccttgactggaagactcggaaccaagagctagaggacaac
gtccacatcagccccaacggctccatcatcaccatcgtgggcacccggcccagcaaccac
ggtgcctaccgctgcgtggcctccaacgcctacggtgtggcccagagtgtcgtgaacctc
agtgtgcacgggccccctacagtgtcggtgctccccgagggccctgtgcgggtgaaagtg
ggaaaatctgtcgccctggagtgtgtcagtgcgggggagccccgctcttctgctcgctgg
acccggactggcaccccaacccacttggagcagcgggcgtacgggcacctggacagccat
acagtgctgcagatttcatcagccaaaccatcagatgcaggcacctatgtgtgcctagct
cagaatgcactgggcacagcacagaagcgggtggaagtgattgtggacacaggcatcgtg
gccccaggcgccccccaggtccaggttgaagaagccgagctgactgtggaggctggacac
acggccaccctgcgctgctcagccacaggcagccccacgcccaccatccactggtccaag
cttcgctccccgctgccctggcagcaccagctggaaggtgacacgctgatcatcccgcgg
gtagcccagcaggactcgggccagtacatctgcaacgccactagccctgtcgggcacgct
gaggccaccatcgccctgcatgtagaaagcccgccatatgccaccacagtcccggagcac
gcctcggtgcgggcaggggagacggtgcaactccagtgcctggctcatgggacaccccca
ctcaccttccagtggagccgtgtgggtggcagcctccctgggagggcaactgccaggaac
gagctgctgctctttgagtctgctgcccctgaggactcaggccgctaccgctgccaggtc
accaacaaggtgggctcagctgaagccttcgcccaggtgctcgtccaaggcccctccggc
tctctccccgccacacccatcccagcaggatccacacccatcccagcaggatccacaccc
accattcaggtcacgcctcagctggagaccaagagcataggggccagtgtcgagttccac
tgcgtcgtgcccagcgaccagggcacccaactccgttggttcaaggaagggggtcagctg
cctcctggccacagtgtgcacgatggggtgctccgaatccagaacttggaccagagctgc
caagggacgtatgtttgccaggcccatggaccctggggacaggcccaagccagtgcccag
ctggttgtccaagctctgccctccgtgctcatcaacatccggacctccgtgcagaccgtg
gtggtcggccatgccgtggagttcgagtgcctggccctgggtgaccccaagcctcaggtg
acatggagcaaagtcggagggcgcctgcggcctggcatcgtgcagagcggaggcgtcgtc
aggatcgcccacgtggagctggccgacgcgggacagtaccgctgcaccgccaccaacacc
gccggcactacccagtctcacgtgctgctactcgtgcaagccttgccccagatctctacg
cccccagaggtccgtgtgcctgctggttctgcagccgtcttcccctgcatggcctctggc
taccctactcctgacatcacctggaccaagctggatgggaacctgccgcctgacagccgc
ctggaggacaacatgctgctgctgccctcagtccgaccccaggatgcaggcacctacgtc
tgcactgccaccaaccgccaaggcaaggtcaaagccttcgcccatctgcaggtgccagag
cgggtggtgccctacttcacccaaacccctcactccttcctgccactgcccaccatcaag
gatgcctacaggaagtttgagatcaagatcaccttccggcctgactcagcagatggcctc
cttctctactcggggatgctgctgtacaatgggcagaagcagatcccggggacccccacc
aacctggcaagcaggcagcccgacttcatctccttcggccttgtgggcggaaggcccgag
ttccggtttgatgcaggctctggcatggccaccattcgccaccccacaccgttggcattg
ggccagttccacacggtgaccctgctgcgcagcctcacccagggatccttgatcgtgggc
agcctggctccagtcaatgggacctcccagggtaagttccagggcctggacctgaatgag
gagctctacctgggtggctatcccgactacggcgccatccccaaagcaggcctgagcagc
ggcttcgtaggctgtgtccgggaactgcgcatccaaggcgaggagatcatcttccatgac
ctcaaccttacagcgcacggcatctcccactgccccacctgtcgggaccggccctgccag
aacgggggcctgtgccaggactcagagagcagcagctacgtgtgtatctgcccagctggc
ttcaccgggagccgctgtgaacactcgcaggccctgcactgccacccagaggcctgtggg
cccgacgccacctgtgtgaaccggcccgacggccgaggctacacctcccagctgtacacc
tgccgctgccacctgggccgctcagggatgaggtgtgaggaaggtgtgactgtgaccacc
ccctccatgtcgggcacgggctcctacctggcactgcctgctctcaccaacacacaccac
gagctacgcctggacgtcgagtttaagccgctggtgcccgacgggatcctgctattcagc
ggggggccaagggggcctgtggaggactttgtgtccctggcgatggttggcagccacctg
gagttccgctacgagttgggatcagggctggccatcctgcggagctccgagccgctggcc
ctgggccgctggcaccgggtgtctgcagagcgtctcaacaaggacggcagcctgcgtgtg
aacagcgggcgccctgtgctgcgctcctcgcctggcaagagccagggcctgaacctgaac
accctcctctacctcggcggcgtggagccatccgtgcagctgcccccggccaccaacgtg
agcgcccacttccgcggctgtgtgggcgaggtgtcagtgaacgggaagcggctggacctc
acctacagcttcctgggcagccagggcatcgggcagtgctacgacagctccccgtgtgag
cgccagccttgccagaatggcgccacgtgcatgcctgcgggcgagtatgagttccagtgc
ctgtgtcgagatggcttcaaaggagacctctgtgagcacgaggagaacccctgccagctc
cgtgagccctgtctgcatgggggcacctgccagggcacccgctgcctctgtcccccaggc
ttctctggcccacgctgccaacaaggctctggacatggcatagcggagtccgactggcat
cttgaaggcagcgggggcaatgatgcccccgggcagtatggagcctatttctatgataac
ggcttccttgttctccctggccgcatcttctccaggagcctgcccgaggtgcccgagacc
atcgagctggaggttcggaccagcacggccagtggcctcctgctctggcagggtgtggag
gtgggtgagtctggacgaggcaaagatttcatcggtctggggcttcaggatgggcatctt
gtcttcagctaccagctgggcagtggggaggcccgccttgtctctgaggaccccatcaat
gatggcgagtggcatcgggtgacggcactgagagagggccggagaggctccatccagttg
gacggcgaggagttggtcagcggccagtccccaggccctaacgtggcggtcaacaccaag
ggcagcatctacatcggcggagccgccgacgtagcggcactgaccgggggcaggttctcc
tcgggcatcacaggctgtatcaagaatctggtgctgcactccgcccggcctggcgcccca
cccccacagccactggacctgcaacaccgcgcccaggcgggggccaacacgcgcccctgc
ccctcatag

DBGET integrated database retrieval system