KEGG   Camelus ferus (Wild Bactrian camel): 102522368Help
Entry
102522368         CDS       T02979                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04146  Peroxisome
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102522368 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102522368 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102522368 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102522368 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    102522368 (SOD2)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102522368 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102522368
NCBI-ProteinID: XP_014409968
LinkDB All DBs
Position
Un
AA seq 176 aa AA seqDB search
MQLHHSKHHAAYVNNLNVAEEKYQEALEKGDITAQVALQPAIKFNGGGHVNHSIFWTNLS
PNGGGEPKGELLEAINRDFGSFSKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVISWENVTQRYLACKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcaccacgcggcctacgtgaataacctgaatgtcgccgag
gagaagtatcaggaggcgctggagaagggtgacattacagctcaggtagctctgcagccg
gcaataaagttcaacggtggaggccatgtcaatcattccattttctggacaaacctgagt
cctaatggtggaggagaacccaaaggggaattactggaagccatcaaccgtgactttggt
tccttcagcaaatttaaggagaagttgaccgctgtatccgttggcgtccaaggctcgggt
tggggttggcttggtttcaataaggaacagggacgcttacagattgctgcttgttctaac
caggatcccttgcaaggaacaacaggtcttattccattgctgggaattgatgtgtgggag
cacgcttactaccttcagtataaaaatgttagacctgattacctgaaagctatttggaat
gtaatcagctgggagaatgtaactcagagatacctggcgtgcaaaaagtag

DBGET integrated database retrieval system