KEGG   Camelus ferus (Wild Bactrian camel): 102522420
Entry
102522420         CDS       T02979                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04120  Ubiquitin mediated proteolysis
cfr04144  Endocytosis
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr04625  C-type lectin receptor signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102522420 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102522420 (MDM2)
   04151 PI3K-Akt signaling pathway
    102522420 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102522420 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102522420 (MDM2)
   04115 p53 signaling pathway
    102522420 (MDM2)
   04218 Cellular senescence
    102522420 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102522420 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102522420 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102522420 (MDM2)
   05202 Transcriptional misregulation in cancer
    102522420 (MDM2)
   05206 MicroRNAs in cancer
    102522420 (MDM2)
   05205 Proteoglycans in cancer
    102522420 (MDM2)
   05203 Viral carcinogenesis
    102522420 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    102522420 (MDM2)
   05220 Chronic myeloid leukemia
    102522420 (MDM2)
   05218 Melanoma
    102522420 (MDM2)
   05219 Bladder cancer
    102522420 (MDM2)
   05215 Prostate cancer
    102522420 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102522420 (MDM2)
   05169 Epstein-Barr virus infection
    102522420 (MDM2)
   05165 Human papillomavirus infection
    102522420 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102522420 (MDM2)
   01522 Endocrine resistance
    102522420 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102522420 (MDM2)
   04121 Ubiquitin system [BR:cfr04121]
    102522420 (MDM2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102522420 (MDM2)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102522420 (MDM2)
Ubiquitin system [BR:cfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102522420 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 102522420
NCBI-ProteinID: XP_006189735
LinkDB
Position
12
AA seq 491 aa
MCNTNMSVSTEGAVSTSQIPPSEQETLVRPKPLLLKLLRSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPLDSGT
PVSERRCHPEGGSDQKDLVQELQEEKPSSSDLVSRPSTSSRRRTVSETEENADELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWFDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKEKMPEKAKQENSTQVEKGFDVP
DCKKSTVNDSRESCVEENEDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQ
DKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgagggtgctgtaagcacctcacagattcca
ccttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttaaggtct
gttggtgcacagaaggacacttacactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgaaaaacaacagcatattgtgtattgttcaaatgac
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcaggaaccattggattcaggcaca
cctgtgagtgaaagaaggtgtcaccccgaaggtggtagtgatcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttccagaccatctacctcatct
agaaggcgaacagttagtgagacagaagaaaatgcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataacatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgctgcgaaagaagcagtagcagtgaatctacagggactccatcg
aatccggatcttgatgctggtgtaagtgaacattcaggtgactggttcgatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtcccttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtgtatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcctgcagtgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggaaagataaagagaaa
atgcctgagaaagccaaacaggaaaactcaacacaagtagaaaagggctttgatgtccct
gactgtaagaaatctacagtgaatgattccagagaatcatgtgttgaggaaaatgaagat
aagatcacacaagcctccctgtcccaagaaagtgaggactattctcagccgtcaacttct
aatagcattatctatagtagccaagaagatgtcaaggagtttgagagggaagaaacacaa
gacaaagaagaaagtgtggaatctagttttccccttaatgccattgaaccatgtgtgatt
tgccaaggtcgacctaaaaatggttgcatcgtccatggcaagacaggacatcttatggct
tgctttacatgcgcaaagaagctaaagaaaaggaataagccctgcccagtatgtagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system