KEGG   Camelus ferus (Wild Bactrian camel): 102523295
Entry
102523295         CDS       T02979                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X2
  KO
K02158  Bcl-2-antagonist of cell death
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04140  Autophagy - animal
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04370  VEGF signaling pathway
cfr04510  Focal adhesion
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr05010  Alzheimer disease
cfr05014  Amyotrophic lateral sclerosis
cfr05020  Prion disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05145  Toxoplasmosis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05165  Human papillomavirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102523295 (BAD)
   04014 Ras signaling pathway
    102523295 (BAD)
   04370 VEGF signaling pathway
    102523295 (BAD)
   04024 cAMP signaling pathway
    102523295 (BAD)
   04022 cGMP-PKG signaling pathway
    102523295 (BAD)
   04151 PI3K-Akt signaling pathway
    102523295 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102523295 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102523295 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102523295 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102523295 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102523295 (BAD)
   04919 Thyroid hormone signaling pathway
    102523295 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102523295 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102523295 (BAD)
   05203 Viral carcinogenesis
    102523295 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102523295 (BAD)
   05212 Pancreatic cancer
    102523295 (BAD)
   05225 Hepatocellular carcinoma
    102523295 (BAD)
   05221 Acute myeloid leukemia
    102523295 (BAD)
   05220 Chronic myeloid leukemia
    102523295 (BAD)
   05218 Melanoma
    102523295 (BAD)
   05211 Renal cell carcinoma
    102523295 (BAD)
   05215 Prostate cancer
    102523295 (BAD)
   05213 Endometrial cancer
    102523295 (BAD)
   05223 Non-small cell lung cancer
    102523295 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102523295 (BAD)
   05014 Amyotrophic lateral sclerosis
    102523295 (BAD)
   05020 Prion disease
    102523295 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102523295 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102523295 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102523295 (BAD)
   05161 Hepatitis B
    102523295 (BAD)
   05160 Hepatitis C
    102523295 (BAD)
   05162 Measles
    102523295 (BAD)
   05168 Herpes simplex virus 1 infection
    102523295 (BAD)
   05165 Human papillomavirus infection
    102523295 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102523295 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102523295 (BAD)
   01524 Platinum drug resistance
    102523295 (BAD)
   01522 Endocrine resistance
    102523295 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102523295
NCBI-ProteinID: XP_006176942
LinkDB
Position
10
AA seq 168 aa
MFQIPEFEQSEQEESSPADRGLGPNPTGDRAPGPGKHCRTATGLLGEAGHQQGQPANSNY
HGGAGAVETRSRHSSHPTGTEDEEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHGSFKGLPRPKSAGTATQMRQSPSWTRFIQSWWGRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagaatttgagcagagtgagcaggaagaatccagccctgcagatagg
ggcctgggccccaaccccactggggacagggccccaggtcccggcaagcactgccgaaca
gccacaggcctcctgggggaagctggtcaccagcaggggcaaccggccaacagcaactac
catggaggcgctggggctgtggaaaccaggagtcgccacagctcccacccaacggggacc
gaggacgaagaagggacggaggaggaggagcccagccccttccggggccgctcgcgctca
gcgccccccaacctctgggctgcacagcgctatggccgcgagctccggaggatgagcgac
gagttccacggctccttcaagggactccctcgcccgaagagcgctggcaccgcgacacag
atgcggcaaagtcccagctggacgcgcttcatccagtcctggtggggccggaacttgggg
agaggcggctccgccccctcccagtga

DBGET integrated database retrieval system