KEGG   Camelus ferus (Wild Bactrian camel): 102523461Help
Entry
102523461         CDS       T02979                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cfr03029]
    102523461 (POLRMT)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     102523461 (POLRMT)
Mitochondrial biogenesis [BR:cfr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    102523461 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N
Motif
Other DBs
NCBI-GeneID: 102523461
NCBI-ProteinID: XP_014407456
LinkDB All DBs
Position
Un
AA seq 897 aa AA seqDB search
MYNMVMRGWAREGPAPSTPPPPPPAPQLNTSPLLREVYAKGCPVSYPRLHLPLKKLQDLF
QQQLRVELATTVTVQSVEKAQPPTEEVLHARKTLADLRATWETALYQELQETKASEARAA
REGRPSLFPYLCLLSEREFVGLLLQTLQALPAQGESLLFLAHELGLRVFNRHIVQRKQLS
KQVQVLEQHYIKYLHLLASDTQVAERCLPRQWWEALGMPEAPHEQPWPVSVLVQLGKQLA
EVLVQAVQMPGSLAAPRGPGSLIPVLYHVYSFRSFRQIGILKPHPAFTQLLEAAAERTLT
FESTEVPMLCPPLPWTSPHSGAFLLSPTKMMRSVEGTQQHQLLLERCPPAQLHGALDALT
QLGNCAWRVNGRVLDLVLELFTDKGCPRLGVPAPPSEAPRPPQGRQTPKSGLLPDLSPAD
KAEMRRELARRLKVAREMQSLRADALCRLSLAQHLRHRVFWLPHNMDFRGRTYPCPPHFN
HLGSDLARALLEFAQGRPLGPHGLDWLKIHLVNLTGLKKRESLQARRDFADQLMEDILDS
ADQPMTGRRWWMEADEPWQALACCMEIARATRAPDPAAYISHFPVHQDGSCNGLQHYAAL
GRDSVGAASVNLLPSDLPQDVYSGVAAQVEVFRRQDAEQGVRVAQVLEGFISRKVVKQTV
MTVVYGVTRYGGRLQIEKRLRELHDFPQEFLWEASHYLVRQVFNSLQEMFSGTRSIQRWL
TESARLISHTGSAVEWVTPLGIPVIQPYHRDSKVMIKGGIQSLTFSSSGDTSQKPNTLKQ
KNGFPPNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCFWTHAADVAVMNQVCREQFVRLH
SQPILHDLSRFLVKRFCSDSRVSKSVWVSRLLDTLLSVPKTGAFDLEQVKRSTYFFS
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacatggtcatgcgcggctgggctcgcgaggggcctgcgccatccacgccgccg
ccgccgccgcctgcaccccagctcaacacctcgccgctgcttagggaggtctacgctaag
ggctgccctgtgtcctacccgaggctgcacctgcccctaaagaagctgcaggacctcttc
cagcagcagctccgtgtggagttggccaccactgtcaccgtgcaatccgtggagaaggcc
cagccgcctaccgaggaggtcctgcatgcgcggaagaccttagcagatctgcgcgccacg
tgggagacagcgctgtaccaggagctacaggagaccaaggccagcgaggcccgtgctgcc
cgtgaaggccgcccctcgctcttcccatacctgtgcctgctgagcgagagggagttcgtg
gggctgttgctgcagaccctgcaggcgctgcctgcgcagggagagtcgcttctcttcctg
gctcatgagctgggtctgcgcgtcttcaaccggcacatcgtgcagaggaagcagctcagc
aagcaggtgcaggtgctggagcagcactacatcaagtacctgcacctgctggcctctgac
actcaggtggcagaacgctgcctgccacggcagtggtgggaggcgctggggatgcctgag
gccccgcatgagcagccctggcccgtgtctgtgctggtgcagctgggcaagcagctggca
gaggtgctggtgcaggcggtgcagatgcccggcagcctggcggcaccccggggccctggc
tcactcatcccggtgctctaccacgtgtactcgttccgcagcttccgccagatcgggatc
ctgaagccgcacccagccttcacgcagctgctggaggccgcggcagagcgcacgctgacc
tttgagtcgaccgaggtgcccatgctgtgccccccgctgccctggacgtcgccccactcg
ggcgccttccttctgagccccaccaagatgatgcgctcggtggagggcacccagcagcac
cagctcctgctggagcgctgtccccctgcccagctgcatggtgccctggacgccctgacc
cagctgggcaactgcgcctggcgcgtcaacgggcgcgtgctggacctggtgctggagctc
ttcaccgacaagggctgcccacgcctgggcgttcccgccccgccctctgaggccccccgg
cctccccagggccgccagacccccaagagtggcctgctgcccgacctctcgccggcagac
aaggcggagatgcggcgagagctggcccgccgcctgaaggtggcacgggagatgcagagc
ctgcgcgctgacgcgctctgccgcctctcgctggctcagcacctgcggcaccgtgtcttt
tggctgccacacaacatggacttccgcggccggacctacccctgcccaccgcacttcaac
cacctgggcagcgacctggcccgtgccctgctggagtttgcccagggccgccctcttggc
cctcatggcctcgactggctcaagatccacctggtcaacctcaccggcctgaagaagcgg
gagtcgctgcaggcgcgccgggattttgcagaccagctgatggaggacatcctggactca
gctgaccagcccatgacgggccggaggtggtggatggaggcggacgagccctggcaagct
ctggcctgctgcatggagatcgctcgggccacacgtgcccccgaccctgccgcctacatc
tcccacttccctgttcaccaggatggttcctgtaatggcctgcaacactacgccgccctg
ggccgggacagcgttggggccgcctccgtcaacctgctgccctcggacctgccgcaggac
gtgtacagcggagtggctgcacaggtggaggtgttccgcaggcaggatgctgagcagggt
gtgcgcgtggcccaggtgctggagggcttcatcagccgcaaggtggtcaagcagacggtg
atgactgtggtgtacggggtcacccgctacggtggccgcctgcagatcgagaagcgcctc
cgggagctccacgacttcccccaggagttcctgtgggaggcctcgcactacctggtgcgc
caggtgttcaacagcctccaggagatgttctcaggcacccggtccatccagcgctggctg
accgaaagtgcccggctcatctcccacacgggttcagctgtggagtgggtcactcccctt
ggcattccggtcatccagccctaccaccgcgactccaaggtcatgatcaaaggtggcatc
cagagccttaccttcagcagcagtggggacaccagccagaagcccaacacgctgaagcag
aagaacggcttcccccccaacttcatccactcgctggactcctcacacatgatgctcacg
gccctgcactgctacaggaagggcctgaccttcgtctcagtccacgactgcttctggacc
cacgcggctgatgtcgcggtcatgaaccaggtgtgcagggagcagttcgtccgcctgcac
agccagcccatcctccatgacctgtccaggttcctggtgaaacggttctgctctgactcc
agggtctccaagagcgtctgggtctcccggctgctggacacgctgctgtcggtgcccaag
acaggggccttcgacctggagcaggtgaagcgctccacgtacttcttcagctga

DBGET integrated database retrieval system