KEGG   Camelus ferus (Wild Bactrian camel): 102523856Help
Entry
102523856         CDS       T02979                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00020  Citrate cycle (TCA cycle)
cfr00190  Oxidative phosphorylation
cfr01100  Metabolic pathways
cfr01200  Carbon metabolism
cfr04714  Thermogenesis
cfr04932  Non-alcoholic fatty liver disease (NAFLD)
cfr05010  Alzheimer disease
cfr05012  Parkinson disease
cfr05016  Huntington disease
Module
cfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102523856 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102523856 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102523856 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102523856 (SDHA)
   05012 Parkinson disease
    102523856 (SDHA)
   05016 Huntington disease
    102523856 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102523856 (SDHA)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102523856 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102523856
NCBI-ProteinID: XP_006189390
LinkDB All DBs
Position
Un
AA seq 692 aa AA seqDB search
MVPLVPQCHHEEQSLLWSLHPNALLYAGPRSQVKWKVPDTELSPSVFQQQPAALQTGARS
FHFTIDGTKRSSAKVSDAISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTK
LFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVE
LENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYD
TSYFVEYFALDLLMEDGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTS
TGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP
VAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAMRLPGISETAMIFAG
VDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHVNGQDQIVPGLYACGEAACASVHGANRL
GANSLLDLVVFGRACALSIAESCRPGDRVPSIKPNAGEESVMNLDKLRFANGSIRTSELR
LNMQKSMQSHAAVFRVGSVLQEGCEKISQLYRDLQHLRTFDRGMVWNTDLVETLELQNLM
LCALQTIYGAEARKESRGAHAREDFKERVDEYDYSKPIQGQQQKPFEQHWRKHTLSYVDI
KTGKVSLEYRPVIDRTLNEADCATVPPAIRSY
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggtaccactggtgcctcagtgccaccatgaggaacagagcctgctctggagcctccac
cccaatgcactgctgtatgctggtcccaggtcccaggttaagtggaaggttccagacact
gaactctcgccatctgtgtttcagcagcagccagcagcattgcagacaggagcccgcagt
ttccacttcaccattgatggcactaagaggtcgtctgccaaagtttcagatgcaatttct
acccagtacccagtagtggatcatgaatttgatgcagtggtggtcggcgctggaggggca
ggcctacgagctgcatttggtctttctgaggcagggtttaacacggcctgtgttacgaag
ctctttcctaccaggtcacacactgtcgcagcccaggggggcatcaacgctgcactgggg
aacatggaggaggacaactggaggtggcacttctatgacactgtgaagggctccgactgg
ctgggggaccaggatgccatccactacatgacggagcaggcccccgcctccgtggtggag
ctggagaactacggcatgccgttcagcagaaccgaggatgggagaatctaccagcgcgcc
tttggaggacagagcctgaagttcgggaaaggcgggcaggcccatcggtgctgctgtgtg
gctgaccgcactggccactcactgctgcacacgttgtatggaaggtctctgcgatatgat
accagctattttgtggagtattttgccttggatctcctgatggaagatggggagtgtcgt
ggagttattgccctgtgcatagaggatgggtccatccaccgcatcagagcaaagaacact
gttgtggccacgggaggctacgggcgcacctacttcagctgcacgtctgcccacaccagc
accggggatggcactgccatgatcaccagggcaggccttccctgccaggacctggagttc
gttcagttccaccccacaggcatatacggtgctggctgtctcatcacggaagggtgtcgc
ggagagggcggcatcctcattaacagtcaaggcgaaaggttcatggagcggtacgcccct
gtcgcaaaggacctggcatccagggacgttgtgtcccggtccatgactctggaaatccgt
gaaggaagaggctgtggccccgagaaggaccatgtctacctgcagctgcatcacctgccc
ccagagcagctggcgatgcgcctgccaggcatctcagagacggccatgatcttcgcaggc
gtggatgtcaccaaggagccaatccccgtgctccccaccgtgcactataacatgggcggc
atccccacaaactacaaggggcaggttctgaagcatgtgaacggccaagatcagatcgtg
ccaggcctatacgcgtgtggggaggccgcctgcgcctctgtgcatggcgccaaccgtctg
ggggccaactcactcctagacctggtggtctttggccgagcgtgcgccctgagcatcgca
gagtcctgcagacccggagatagggttccctcgattaaaccaaatgctggggaagaatct
gtcatgaatcttgacaaattgagatttgctaatggaagcataagaacatcggaactgcga
ctcaacatgcagaagtcgatgcagagccacgctgcagtgttccgtgtggggagcgtgctg
caggagggctgtgagaagatcagccagctctaccgcgacctgcagcacctgaggacgttt
gaccggggaatggtttggaacactgacctggtggagaccctggagctgcagaacctgatg
ctctgtgccctgcagaccatttacggagcagaggcccggaaggagtcacggggcgctcat
gccagggaggatttcaaggagcgggttgatgagtatgattactccaagcccatccagggg
cagcagcagaagccgtttgagcagcactggaggaagcacacgctttcctacgttgacatc
aagacagggaaggtctcgctggaatacagacctgtcatcgacagaacgttgaacgaggct
gactgcgccactgttcccccagccatccgctcctactga

DBGET integrated database retrieval system