KEGG   Camelus ferus (Wild Bactrian camel): 102523860
Entry
102523860         CDS       T02979                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X4
  KO
K10140  DNA damage-binding protein 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr03420  Nucleotide excision repair
cfr04115  p53 signaling pathway
cfr04120  Ubiquitin mediated proteolysis
cfr05161  Hepatitis B
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102523860 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102523860 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102523860 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102523860 (DDB2)
   05202 Transcriptional misregulation in cancer
    102523860 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102523860 (DDB2)
   05212 Pancreatic cancer
    102523860 (DDB2)
   05225 Hepatocellular carcinoma
    102523860 (DDB2)
   05226 Gastric cancer
    102523860 (DDB2)
   05214 Glioma
    102523860 (DDB2)
   05216 Thyroid cancer
    102523860 (DDB2)
   05220 Chronic myeloid leukemia
    102523860 (DDB2)
   05217 Basal cell carcinoma
    102523860 (DDB2)
   05218 Melanoma
    102523860 (DDB2)
   05213 Endometrial cancer
    102523860 (DDB2)
   05224 Breast cancer
    102523860 (DDB2)
   05222 Small cell lung cancer
    102523860 (DDB2)
   05223 Non-small cell lung cancer
    102523860 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102523860 (DDB2)
   05169 Epstein-Barr virus infection
    102523860 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfr04121]
    102523860 (DDB2)
   03400 DNA repair and recombination proteins [BR:cfr03400]
    102523860 (DDB2)
Ubiquitin system [BR:cfr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102523860 (DDB2)
DNA repair and recombination proteins [BR:cfr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102523860 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 102523860
NCBI-ProteinID: XP_006190299
LinkDB
Position
10
AA seq 427 aa
MAPRKRPETQKTPEVVVRPKSKRNRSPRELEPEAKKLCVKGPGSSRRFDSGCLWAGLASL
RVSASCSSIVRALHQHKLGRATWPSLQQGLQQSFLHSLASYRIFQKAAPFDRRATSLAWH
PAHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGT
TRLQDFKGNTLRVFATSDTCNIWFCSLDVSVKSRVVVTGDNVGHVILLNMDGRELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLYSLPHRHPVNAAHFSPDG
AQLLTTDQKSEIRVYSASQWDCPPHLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPN
FKSCTPHELRTIDVFDGSSGKMMYQLYDPESSGIMSLNEFNPMGDTLASVMGYHILIWSQ
EETGMRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagacccccgaggtggttgtgcgtcccaag
agcaagaggaacagaagcccccgggagctggaacccgaggccaagaagctctgtgtgaag
ggccccggttctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
cgggtctcggcatcatgcagcagcatcgtcagggccctccaccagcataagctgggcaga
gctacctggccatcactacagcagggtcttcagcagtcctttttgcactctctggcttct
taccggatattccaaaaggctgccccttttgacaggagggccacatccctggcatggcac
ccagctcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaac
tttggcataaaggacaaacccaccttcattaaagggattggagctggaggcagcatcact
gggctgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaacc
actaggctgcaagactttaaaggcaacactctccgagtttttgccacctcagacacctgc
aacatctggttttgcagcctggatgtgtctgtcaaaagccgagtggtggtcacaggagac
aatgtggggcatgtgatcctgctgaacatggatggcagggagctttggaatctgagaatg
cacaaaaagaaagtgacccatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagc
ttcctctactcactgccacacaggcatcctgtcaacgcagctcatttcagtcccgatgga
gcccagctcctgaccactgaccagaagagtgagatccgggtttactccgcctctcagtgg
gactgccccccacacctgatcccgcaccctcaccgccactttcagcacctgacacccatc
aaggcaacctggcatcctcggtacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccccatgaattaaggacgatcgatgtgtttgatggaagctcagga
aagatgatgtatcagctgtatgacccagaatcttctggtatcatgtcgctcaatgagttc
aatcccatgggggacacgctggcctccgtgatgggttatcacattctcatttggagccag
gaggaaactgggatgcggaaatga

DBGET integrated database retrieval system