KEGG   Camelus ferus (Wild Bactrian camel): 102523889
Entry
102523889         CDS       T02979                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04014  Ras signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04360  Axon guidance
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04931  Insulin resistance
cfr05168  Herpes simplex virus 1 infection
cfr05205  Proteoglycans in cancer
cfr05211  Renal cell carcinoma
cfr05220  Chronic myeloid leukemia
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102523889 (PTPN11)
   04630 JAK-STAT signaling pathway
    102523889 (PTPN11)
   04072 Phospholipase D signaling pathway
    102523889 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102523889 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    102523889 (PTPN11)
   04670 Leukocyte transendothelial migration
    102523889 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102523889 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102523889 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    102523889 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102523889 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102523889 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102523889 (PTPN11)
   05211 Renal cell carcinoma
    102523889 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102523889 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102523889 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102523889 (PTPN11)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102523889 (PTPN11)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102523889 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 102523889
NCBI-ProteinID: XP_032327844
LinkDB
Position
32
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLTDQASGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccgaatatcactggcgtggaggcggaaaacctactg
ttgacaagaggagtggatggcagttttttggcacggcccagtaaaagtaaccccggagac
ttcacactttctgtcagaagaaatggagctgtcacccacatcaagattcagaacactggt
gactactatgacttgtatggaggggagaagtttgccactttggctgagttggtccagtat
tacatggaacatcatgggcaattgaaagagaagaatggagatgttattgagctcaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaggcagagaaattgttaactgagaaaggaaaacatggtagctttcttgtacgggagagc
cagagccaccctggagattttgttctctctgtccgcaccggagatgacaaaggggagagc
aacgacggcaagtctaaagtgacccacgtcatgatccgctgtcaggaattgaaatatgac
gttggtggaggagaacggtttgactctttgacagatctcgtggagcattacaagaagaat
cctatggtagaaacgttgggcactgtactacaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatagaaagtcgagttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccgaaaagagggtcagaggcaagaaaataaaaacaaaaatagatataaa
aacatcctgccctttgaccataccagggttgtcctacatgacggtgatcccaatgagcct
gtttcagattacatcaacgcaaatattatcatgcctgaatttgaaaccaagtgcaacaac
tcaaagcccaaaaagagttacatcgccacgcaaggctgcctgcaaaacacagtgaatgac
ttttggcggatggtgtttcaagagaactctcgagtgattgtcatgacaacgaaagaagtg
gaaagaggaaagagtaaatgtgtcaaatactggcctgacgagtacgctctgaaagaatac
ggggtcatgcgcgtcaggaacgtcaaagaaagtgccgctcacgattatacattgagagaa
cttaaactttcgaaggttggacaagctctactccaggggaatacggagagaacggtctgg
cagtaccactttcggacctggccggaccacggagtgcccagcgacccggggggcgtgctg
gacttcctggaggaggtccaccataagcaggagagcatcatggacgcggggccggtggtg
gttcactgcagtgctggaattggccggacggggacgttcattgtgattgatattcttatt
gacatcatcagggagaaaggcgtcgactgcgacattgacgttcccaaaaccattcagatg
gtgcggtctcagaggtcagggatggtccagacggaagcgcagtaccggttcatctatatg
gccgtccagcattatattgaaacactacagcgcaggatcgaagaagagcagaaaagcaag
aggaaagggcacgaatacacaaatattaagtattccctaacggaccaggcaagtggagat
cagagtcccctcccaccttgtaccccaacgccatcctgtgcagaaatgagagaagataat
gctagagtctatgaaaatgtgggtctgatgcagcagcagaaaagtttcagatga

DBGET integrated database retrieval system