KEGG   Camelus ferus (Wild Bactrian camel): 102524149
Entry
102524149         CDS       T02979                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04020  Calcium signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04260  Cardiac muscle contraction
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04270  Vascular smooth muscle contraction
cfr04713  Circadian entrainment
cfr04720  Long-term potentiation
cfr04723  Retrograde endocannabinoid signaling
cfr04724  Glutamatergic synapse
cfr04725  Cholinergic synapse
cfr04726  Serotonergic synapse
cfr04727  GABAergic synapse
cfr04728  Dopaminergic synapse
cfr04742  Taste transduction
cfr04911  Insulin secretion
cfr04912  GnRH signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04924  Renin secretion
cfr04925  Aldosterone synthesis and secretion
cfr04927  Cortisol synthesis and secretion
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04934  Cushing syndrome
cfr04935  Growth hormone synthesis, secretion and action
cfr05010  Alzheimer disease
cfr05020  Prion disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05031  Amphetamine addiction
cfr05410  Hypertrophic cardiomyopathy
cfr05412  Arrhythmogenic right ventricular cardiomyopathy
cfr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102524149 (CACNA1C)
   04020 Calcium signaling pathway
    102524149 (CACNA1C)
   04024 cAMP signaling pathway
    102524149 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102524149 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102524149 (CACNA1C)
   04929 GnRH secretion
    102524149 (CACNA1C)
   04912 GnRH signaling pathway
    102524149 (CACNA1C)
   04921 Oxytocin signaling pathway
    102524149 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102524149 (CACNA1C)
   04924 Renin secretion
    102524149 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102524149 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102524149 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102524149 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102524149 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102524149 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102524149 (CACNA1C)
   04727 GABAergic synapse
    102524149 (CACNA1C)
   04725 Cholinergic synapse
    102524149 (CACNA1C)
   04728 Dopaminergic synapse
    102524149 (CACNA1C)
   04726 Serotonergic synapse
    102524149 (CACNA1C)
   04720 Long-term potentiation
    102524149 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102524149 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102524149 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102524149 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102524149 (CACNA1C)
   05020 Prion disease
    102524149 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102524149 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102524149 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102524149 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102524149 (CACNA1C)
   05414 Dilated cardiomyopathy
    102524149 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102524149 (CACNA1C)
   04934 Cushing syndrome
    102524149 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfr04040]
    102524149 (CACNA1C)
Ion channels [BR:cfr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102524149 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102524149
NCBI-ProteinID: XP_032329230
LinkDB
Position
34
AA seq 2171 aa
MRPPSSVLGRAAWWVPSREDHIRHPGCSRGGSAAPSTSGRDPQGAALLVATCPSYGSPRP
AHTNMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQ
YGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYI
PFPEDDSNATNSNLERVEYLFLIVFTVEALLKVIAYGLLFHPNAYLRNGWNLLDFIIVVV
GLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAM
VPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYSEEGAADVPAEDDPSPCALETGHGRQ
CQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYF
VSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAE
DIEPENEDEGLDEERPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRY
WRRWNRFCRRKCRAAVKSSIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLA
LFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPLGISVLRCVRLL
RIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTR
RSTFDNFPQSLLTVFQILTGEDWNSVMHDGIMAYGGPSFPGMLVCIYFIILFICGNYILL
NVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMVEKPAVEETKEEKIE
LKSITAAGESPPATKINMDDLQPNESEDKASYPRPEATGEEDEEEPEMPVGPRPRPLSEL
HLKEKAVPMPEASAFFIFSANNRFRLRCHRVVNDSVFTNLILFFILLSSVSLAAEDPVRH
TSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFG
IQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFAC
IGVQLFKGKLYTCSDSSKQTEAECRGNYITYKDGEVDHPIVQPRSWENSKFDFDNVLAAM
MALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFV
IVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLM
FVLILLNTICLAMQHYGQSCLFKIAMNVLNMLFTGLFTVEMLLKLIAFKPKGYFSDPWNV
FDFLIVIGSVIDVILSETNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEG
IRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQA
VLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAF
LIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQ
PPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEEL
RAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPCQ
RSALSLQAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGN
HVGYYPSDSRSAFPQTFTTQRPLHISKAGSSQADPESPSHEKLVDSTFTPSSYSSTGSNA
NINNANNTALGRCPRPAGDPGAVSTLEGCGTPLSPAVRLQEAAWRHSSKRCPSRESPIAM
MCPEEASRGEARDMQTREDAEFGSEPSLIPTEMLSYQEDESRQLTPPEEDRRDVRLSPKR
GFLRSASLGRRASFHLECLKRQRNHWGDVSQKTVLPLHLVHQQALAVAGLSPLLQRSHPP
STLPLPCTTPPATPGARGRPQQPVPTLQLEGAEAVEKLDSSFPSIHCSHRPGEPTXQGAP
RRARPVSLMVPSPAVARGRQLHGSASSLVEAVLISEGLGKFAQDPKFLEATTQELADACD
MTIEEMESAADNILSGGAGQSPNGTLLPFANCRDPGPDRAGGTEDAAWVPSPEPPESEEE
LLDHGALVSSL
NT seq 6516 nt   +upstreamnt  +downstreamnt
atgcgtccaccctcctccgtcctggggcgggcggcgtggtgggtgccgtcccgggaagac
cacatccgacatccagggtgttctcggggaggaagtgcagccccttcaacctcaggccgt
gacccccaaggagctgctttgctcgtggccacatgtcccagctatgggagcccgcgcccg
gctcataccaacatgaacgccaacgcggccgcggggctggcccccgagcacatccccacg
ccgggggccgcgctgtcctggcaggcggccatcgacgcggcccggcaggccaagctgatg
ggcagcgccggcaacgccaccatctccacggtcagctccacgcagcgcaagcggcagcag
tacggcaaacccaagaagcagggcagcaccacggccacccgcccgccccgcgcgctgctc
tgcctgaccctgaagaaccccatccggagggcctgcatcagcattgtggagtggaagcca
tttgaaatcattattttactgacgatttttgccaattgcgtggccttagccatctacatc
cccttcccagaagacgactccaacgccaccaattccaacctggagcgagtggagtacctc
ttcctcatcgttttcactgtggaggcgctgttaaaagtcattgcctacggactcctcttc
cacccgaacgcttacctgcgcaacggctggaatctcctcgacttcatcatcgtggttgtc
gggctcttctctgccatcttagagcaagccaccaaagcggacggggcgaacgcactcgga
gggaagggggctggattcgacgtgaaggcgctgagggcgttccgcgtgctgcggcccctg
cggctggtgtccggcgtcccaagcctgcaggtggtcctgaactccatcatcaaagccatg
gtgcccctgctgcacatcgcgctgctggtgctgttcgtcatcatcatctacgccatcatc
ggcctggagctcttcatgggaaagatgcacaagacctgctacagcgaggagggcgccgca
gatgtcccggcagaagacgacccctccccctgcgccctggagacgggccacgggcgccag
tgccagaatggcacggtgtgcaagccagggtgggacgggcccaagcacggcatcaccaac
tttgacaacttcgccttcgccatgctcaccgtgttccagtgcatcaccatggagggctgg
accgacgtgctgtactggatgcaggacgctatgggctacgagttaccctgggtgtatttt
gtcagtctggtcatcttcggatcctttttcgttctaaatctggttcttggtgtgttgagc
ggagagttttccaaagagagggagaaggccaaggcccggggcgacttccagaagctgcgg
gagaagcagcagctggaggaggacctgaagggctacctggactggatcacgcaggcggag
gacatagagcccgagaacgaggacgagggcctggacgaggagagaccccgcaacatgagc
atgcccaccagtgagaccgagtcggtcaacaccgaaaacgtggctggaggcgacatcgag
ggagaaaactgcggggcccgactggcccaccggatctccaagtccaagttcagccgctac
tggcgccgatggaaccggttctgcaggaggaagtgccgtgcggccgtgaagtcgagcatc
ttctactggctggtcatcttcctggtgttcctcaacacgctcaccatcgcctccgagcac
tacaaccagccccactggctcacggaggtccaagacacagccaacaaggccctgctggcc
ctcttcacggccgagatgctgctcaagatgtacagcctggggctgcaggcctacttcgtg
tcgctcttcaatcgcttcgactgcttcatcgtgtgcggcggcatcctggagaccatcctg
gtggagaccaaggtcatgtccccgctgggcatctccgtgctgagatgcgtccgcctcctg
cgcatatttaagatcacgaggtactggaactccctgagcaacctggtggcgtccctgctg
aactcggtgcgctccatcgcctccctgctgctgctgctcttcctcttcatcatcatcttc
tccctcctggggatgcagctcttcggagggaagttcaacttcgacgagatgcagacccgc
aggagcacgttcgacaactttccgcagtccctgctcaccgtgtttcagatcctgaccggg
gaggactggaactcggtgatgcatgatggcatcatggcttatggcggcccctcttttcca
gggatgctagtctgtatttacttcatcatcctcttcatctgtgggaactatatcctactg
aatgtgttcttggccattgctgtggacaacctggcagatgctgagagcctcacctctgcc
cagaaggaggaggaagaagagaaggagagaaagaagctggccaggactgccagcccagag
aagaaacaagagatggtggagaagccagcagtggaggagaccaaggaggaaaaaattgag
ctgaaatccatcacagccgccggagagtccccgccggccaccaagatcaacatggatgac
ctccagcccaacgaaagtgaggacaaggcttcctacccccgcccggaagcgacaggagag
gaggacgaggaggagccggagatgccggtgggcccgcgcccgcgccctctctctgagctg
cacctgaaggagaaggccgtgcccatgccagaagccagcgctttcttcatcttcagcgcc
aacaacaggttccgccttcggtgccaccgcgtcgtcaacgactccgtcttcaccaacctg
atcctcttcttcatcctgctcagcagcgtctccctggccgccgaggacccggtgcggcac
acctccttcaggaaccacattctgttttattttgacattgttttcactaccattttcacc
attgaaattgctctgaagatgaccgcctacggggccttcctgcacaagggctccttctgc
cggaactacttcaacatccttgacctgctggtggtcagcgtgtccctcatctccttcggc
atccagtccagcgccatcaatgtggtgaagatcctgcgggtcctcagggtgctcaggccc
ctccgggccatcaacagggccaaggggctgaagcacgtggtgcagtgcgtgttcgtggcc
atccgcaccatcgggaacatcgtgatcgtcaccacgctgctccagttcatgttcgcctgc
atcggggtccagctcttcaagggcaagctctacacctgttccgacagctccaagcagacg
gaggcggagtgcagggggaactacatcacgtacaaggacggggaggttgaccaccccatc
gtccagccccgcagctgggagaacagcaagtttgacttcgacaacgttctggccgccatg
atggccctgttcaccgtctccacctttgaggggtggccagagctgctgtaccgctccatc
gactcccacacggaggacaagggccccatctacaactaccgcgtggagatctccgtcttc
ttcatcatctacatcatcatcatcgccttcttcatgatgaacatattcgtgggcttcgtc
atcgtcaccttccaggagcagggggagcaggagtacaagaactgcgagctggacaagaac
cagcggcagtgcgtggagtacgccctgaaggcccggcccctgcggaggtacatccccaag
aaccagcaccagtacaaggtgtggtacgtggtcaactccacctacttcgagtacctgatg
ttcgtcctcatcctgctcaacaccatctgcctggccatgcagcactacgggcagagctgc
ctgttcaaaatcgccatgaacgtcctgaacatgctcttcaccggcctcttcacagtggag
atgcttctcaagctcatcgccttcaagcccaagggttactttagtgacccctggaatgtc
tttgacttcctcatcgtaattggcagcgtaattgacgtcattctcagtgagacgaatcca
gctgaacatacccaatgttctccctttatgaacgcggaggagaactcccgcatctccatc
accttcttccgcctcttccgggtcatgcgcctggtcaaactgctgagccgcggggagggc
atccggaccctgctgtggaccttcatcaagtcctttcaggccctgccctacgtggccctc
ctgatcgtgatgctcttcttcatctacgccgtcatcgggatgcaggtgtttgggaaaatc
gccctgaacgacacgacggagatcaaccggaacaacaacttccagaccttcccccaggcc
gtgctgctgctcttcaggtgcgccacgggtgaggcctggcaggacatcatgctggcctgc
atgcctgggaagaagtgcgcccccgagtcggagccaggcaacagcacggagggggagacg
ccctgcggcagcagcttcgccgtcttctatttcatcagcttctacatgctgtgtgccttc
ctgatcatcaacctctttgtggccgtcatcatggacaactttgactacctgacccgggac
tggtccatcctgggtccccaccacttggacgagtttaagagaatctgggcggagtacgac
cctgaagccaagggccgcatcaaacacctggatgtggtgacgctgctgcggcgcatccag
cccccgctgggtttcgggaagctgtgccctcaccgcgtggcctgcaaacgcctggtctcc
atgaacatgcctctcaacagcgacgggacggtcatgttcaacgccacgctgttcgccctg
gtccggacagccctgaggatcaaaacggaagggaacctggagcaggccaacgaggagctg
cgggccatcatcaagaagatctggaagcggacgagcatgaagctgctggaccaggtggtg
ccgcccgcaggagacgacgaggtcacggtcggcaagttttacgccaccttcctgatccag
gagtacttccggaagtttaagaagcgcaaagagcagggcctcgtgggcaagccctgccag
aggagcgccctgtccctgcaggctggcctgcgcaccctgcatgacctggggcccgagatc
cgcagggccatctccggggacctgacggccgaggaggagctggacaaagccatgaaggag
gcggtgtccgcagcctcggaggacgacatcttcaggagggccggaggcctgttcggcaac
cacgtcggctactaccccagcgacagccggagcgccttcccgcagaccttcaccacgcag
cggcccctgcacatcagcaaggcgggcagcagccaggccgaccccgagtcgccctcccac
gagaagctagtggactccaccttcacacccagcagctactcatccacgggctccaacgcc
aacatcaacaatgccaacaacacggccctgggccgctgcccccgccccgccggcgacccg
ggggctgtcagcacgctggagggctgcgggacccccttgtcccccgccgtccggctgcag
gaggccgcgtggaggcacagctccaagaggtgcccctcccgggagagtccgatagccatg
atgtgcccagaggaggcctctcggggcgaggcccgtgacatgcagacgcgtgaggacgcg
gagttcggcagcgagcccagcctgatccccaccgagatgctctcctatcaggaagacgag
agccgacagctgacaccccccgaggaggacaggagggacgtccggctatctccaaagaga
ggcttcctgcgctccgcctccctaggtcgaagggcctccttccacctggagtgtctgaag
cggcagaggaatcactggggagacgtctctcagaagacggtcctgcccttgcacctggtt
caccagcaggcattggcagtggcgggcctgagccccctcctccagagaagccatcccccc
agcaccctccccctgccgtgcacaacaccccctgccacgccgggcgcccgcggccggccc
cagcagcccgtgcccaccctgcagctggagggggccgaggccgtggagaagctcgacagc
agcttcccgtccatccactgcagccaccggccgggggagcccacgnnccagggtgccccc
cggagagcccggcctgtgtccctgatggtgcccagcccagcggtggcccggggccgccag
ctccacggcagcgccagcagcttggtggaagcggtcttgatctcggaaggactgggaaag
tttgctcaggaccccaagttcctggaggccaccacgcaagagctggcagacgcctgcgac
atgacgatagaggagatggagagtgcggccgacaacattctcagcgggggcgccgggcag
agccccaacggcaccctgcttccttttgcaaactgcagggacccggggccggacagagcg
gggggcacggaggatgcggcctgggtgcccagccccgagccccctgagagcgaggaggag
ctcctggaccatggggccttggtcagcagcctgtag

DBGET integrated database retrieval system