KEGG   Camelus ferus (Wild Bactrian camel): 102524296
Entry
102524296         CDS       T02979                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00220  Arginine biosynthesis
cfr00330  Arginine and proline metabolism
cfr01100  Metabolic pathways
cfr04020  Calcium signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04611  Platelet activation
cfr04915  Estrogen signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04931  Insulin resistance
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102524296 (NOS3)
   00330 Arginine and proline metabolism
    102524296 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102524296 (NOS3)
   04371 Apelin signaling pathway
    102524296 (NOS3)
   04066 HIF-1 signaling pathway
    102524296 (NOS3)
   04020 Calcium signaling pathway
    102524296 (NOS3)
   04071 Sphingolipid signaling pathway
    102524296 (NOS3)
   04022 cGMP-PKG signaling pathway
    102524296 (NOS3)
   04151 PI3K-Akt signaling pathway
    102524296 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102524296 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102524296 (NOS3)
   04921 Oxytocin signaling pathway
    102524296 (NOS3)
   04926 Relaxin signaling pathway
    102524296 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102524296 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102524296 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102524296 (NOS3)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102524296 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15 DEC-1_N
Other DBs
NCBI-GeneID: 102524296
NCBI-ProteinID: XP_032339034
LinkDB
Position
7
AA seq 1200 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPAAPAPEPSRAPAPAPPPAPDHSPPLTRPP
EAPKFPRVKNWEVGSIAYDTLSAQSQQDGPCTPRRCLGSLVFPRKLPGRPSQGPPPAEQL
LSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPR
CVGRIQWGKLQVFDARDCGSAQEMFTYICNHIKYATNRGNLRSAITVFPQRTPGRGDFRI
WNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELF
ALPPELVLEVPLEHPTLEWFATLGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIG
TRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHHAA
TASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPDPWKGS
ATKGVGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYASETGRAQSYAQQLGRLFR
KAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRP
EQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAF
ARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGKDAKAAAQDI
FSPRRSWKRQRYRLSVQAESLQLLPGLIHVHRRKMFQATVRSVENLQSSKSTRATILVRL
DTGGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTEPVAVEQLEKGSPGGPPPC
WVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPSEQQELETLSQDPRRYEEW
KWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSANPGEIHLTVAVLAYR
TQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRG
FWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSREPDS
PKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAG
DVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDLPGPDTPGS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgggcaacctgaagagcgtgggccaggagcccgggccgccctgcggcctggggctgggg
ctgggcctcgggctgtgtggcaagcagggcccggccgccccagcacctgagcccagccgg
gcaccagcacctgcacccccaccggcgccagaccacagccccccgcttacccggcctcca
gaggcgcccaagttccctcgtgtgaagaactgggaggtgggaagcatcgcctacgacact
ctgagtgctcagtcacagcaggacgggccctgtaccccccgacgctgcctgggctccctc
gtatttccacggaaactgccaggccggccctcccagggccctccacccgctgagcagctg
ctgagccaggcccgggatttcatcaaccagtactacagctccatcaagaggagtggttcc
caggctcacgagcagcggcttcaggaggtggaagctgaggtggcagccacggggacctac
cagcttcgggagagcgagctggtgttcggggccaagcaggcctggcgcaacgctccccgc
tgtgtgggccggatccagtgggggaagctgcaggtgtttgatgcccgggattgcggctct
gcacaggagatgttcacttacatctgcaaccacatcaagtatgccactaaccggggcaac
cttcgctcggccatcacagtattcccccagcgcactccgggccgtggagacttccgaatc
tggaacagccagctggtgcgctacgcaggctacaggcagcaggatggctccgtgcggggc
gatccagccaacgtggagatcactgagctctgtatccagcatggctggaccccaggaaac
ggtcgctttgatgtgctgcccctgctgctccaggccccagatgagcctccagaactcttt
gctctgccccccgagctggtccttgaggtgcccctggagcacccaacgctggagtggttt
gcaaccctgggcctgcgctggtacgccctcccggcagtgtccaacatgctgctggaaatt
gggggcctggagttccctgcggcccccttcagcggctggtacatgagcactgagatcggc
actcggaatctgtgcgatcctcaccgctacaacatcctggaggatgtggccgtctgcatg
gacctggatacccggaccacctcgtccctctggaaagacaaggctgcagtggaaatcaac
ttggctgtgctgcacagttatcagctggccaaagtgaccatcgtggatcaccacgcagcc
acggcctccttcatgaagcacctggagaatgagcagaaggcgaggggaggctgccctgcc
gactgggcctggatcgtgccccctatctcgggcagcctcacacctgtcttccatcaggag
atggtcaactatgtcctgtcccctgccttccgctaccagccagacccctggaaggggagt
gcgaccaagggcgtcggcatcaccagaaagaagacctttaaggaagtggccaacgcagtg
aagatctctgcctcactcatgggcaccgtgatggcgaagcgagtgaaggcaacaattctg
tatgcctccgagactggccgggcccagagctacgcgcagcagctggggaggcttttccgg
aaggctttcgacccccgggtcctgtgcatggatgagtatgatgtggtgtccctggagcat
gagactctggtgttggtggtgaccagcacatttgggaatggcgatccgcccgagaatgga
gagagctttgcagcagccctgatggagatgtcaggcccctacaacagctcccctcggccg
gaacaacacaagagttacaaaatccgcttcaacagtgtctcctgctcagacccactggtg
tcctcctggcggcggaaaagaaaggagtccagcaacacagacagtgcaggggcactgggg
accctcaggttctgtgtgttcgggctgggctcccgggcgtacccccacttctgcgccttt
gctcgtgcggtggacacacggctggaagagctgggtggggagcggctcctgcagctgggc
cagggcgacgagctgtgtggccaggaggaggccttccgcggctgggcccaggctgccttc
caggcctcctgtgagacgttctgcgttggaaaagatgccaaggccgctgcccaggacata
ttcagccccagacggagttggaaacgccagaggtaccgactgagtgtccaggccgagagc
ctccagctgctgccaggcctgatccacgtgcacaggcggaagatgttccaagctacagtc
cgctcagtggaaaacctgcaaagcagcaagtccacccgggccaccatcctggtgcgcctg
gacactggaggccaggaggggctccagtaccagccaggagaccacataggcatctgcccg
cccaaccggccgggcctcgtggaggcgctgctgagccgtgtggaggacccgccgccgccc
accgagcctgtggcagtggagcagctggagaagggcagccctggtggacctcctccctgc
tgggtgcgggatccccggctgcccccgtgcacgctgcgccaggctctcaccttctttctg
gacatcacttccccgcccagccctcaacttcttcgactgctcagcaccctagccgaagag
cccagcgaacagcaggagcttgaaaccctcagccaggacccccggcgctatgaggagtgg
aagtggttccgctgccccacgctgttggaggtgctggagcagtttccatctgtggcactg
cctgccccactgctcctcacccagctgcccctgctccagccccggtactactcggtcagt
tcagcacccagcgccaatccaggagagatccacctcacagtcgccgtgctggcatacagg
acacaagatgggctgggtcccctgcactacggggtctgctccacatggctgagccaactc
aagactggagaccctgtgccctgcttcatcagaggggctccctccttccggctgccacct
gatcccagcttgccctgcatcctggtgggccctggcactggcatcgccccctttcgagga
ttttggcaggagcggctgcatgacattgagagcaaagggctgcaacccgcccccatgacc
ttggtgttcggctgccgatgctcccagctcgaccatctctaccgtgacgaggtgcaggat
gcccagcagcgcggggtgtttggccgcgtcctgaccgccttctcccgggaacccgacagt
cctaagacctatgtgcaggacatcttgcggacagagcttgctgccgaggtgcatcgcgtc
ctctgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatggcaaccaacgtc
ctgcagaccgtgcagcgcatcttggcaacggagggcgacatggagctggacgaggccggc
gacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacatttttgggctcacg
ctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttgcaggagcgg
catctccggggcgcagtgccctgggcgttcgacctgccgggaccagacacccctggctcc
tga

DBGET integrated database retrieval system