KEGG   Camelus ferus (Wild Bactrian camel): 102524338
Entry
102524338         CDS       T02979                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04114  Oocyte meiosis
cfr04140  Autophagy - animal
cfr04144  Endocytosis
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04510  Focal adhesion
cfr04520  Adherens junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04730  Long-term depression
cfr04913  Ovarian steroidogenesis
cfr04914  Progesterone-mediated oocyte maturation
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05205  Proteoglycans in cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102524338 (IGF1R)
   04014 Ras signaling pathway
    102524338 (IGF1R)
   04015 Rap1 signaling pathway
    102524338 (IGF1R)
   04066 HIF-1 signaling pathway
    102524338 (IGF1R)
   04068 FoxO signaling pathway
    102524338 (IGF1R)
   04151 PI3K-Akt signaling pathway
    102524338 (IGF1R)
   04152 AMPK signaling pathway
    102524338 (IGF1R)
   04150 mTOR signaling pathway
    102524338 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102524338 (IGF1R)
   04140 Autophagy - animal
    102524338 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102524338 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102524338 (IGF1R)
   04520 Adherens junction
    102524338 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    102524338 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    102524338 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    102524338 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    102524338 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    102524338 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    102524338 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102524338 (IGF1R)
   05202 Transcriptional misregulation in cancer
    102524338 (IGF1R)
   05205 Proteoglycans in cancer
    102524338 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102524338 (IGF1R)
   05214 Glioma
    102524338 (IGF1R)
   05218 Melanoma
    102524338 (IGF1R)
   05215 Prostate cancer
    102524338 (IGF1R)
   05224 Breast cancer
    102524338 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102524338 (IGF1R)
   01522 Endocrine resistance
    102524338 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102524338 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfr04090]
    102524338 (IGF1R)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102524338 (IGF1R)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102524338 (IGF1R)
CD molecules [BR:cfr04090]
 Proteins
  102524338 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 102524338
NCBI-ProteinID: XP_032324756
LinkDB
Position
27
AA seq 1369 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENHECCHPECLGSCS
APDDDAACVACRHYYYAGVCVPSCPPNTYRFEGWRCVDRDFCANIPSAESSDSEGFVIHD
GECMQECPSGFIRNGTQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIVTWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDIEPGILLQGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKGEDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEY
RKVFENFLHNAIFVPRPERKRREVMQVANTTTSSRSRNTTVVDTYNITDPEELETEYPFF
ESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPV
TWEPRPENSIFLKWPEPENPNGLILMYEIKYGSLVEDQRECVSRQDYRKYGGAKLNRLNP
GNYTARIQATSLSGNGSWTDPVFFYVQAKTTYENFIHLIIALPVAVLLIVGGLVIMLYVF
HRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVA
KGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVI
MELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSSSLPLPE
RHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctcc
gccgcgctctcgctgtggccgacgagtggagaaatctgcgggccaggcatcgacatccgc
aatgactaccagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacctgctgctgttccgcgtggccggcctggagagcctcggcgacctcttc
cccaacctcacggtcatccgtggctggaagctcttctacaactacgccctggtcatcttc
gagatgaccaacctcaaggacatcgggctgtacaacctgaggaacatcacccggggggcc
atcaggatcgagaagaatgccgacctctgctacctctccacggtggactggtccttgatc
ctggacgccgtgtccaataactacatcgtggggaacaagcccccgaaggagtgcggggac
ctgtgtccagggacgatggaggagaagccgttgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacgaaccgctgccagaaaatgtgcccgagcgcgtgcggg
aagcgggcgtgcacggagaaccacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcccgacgacgacgcggcctgcgtggcctgccgccactactactacgccggcgtctgc
gtgcccagctgcccgcccaacacctaccgcttcgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccccagcgccgagagcagcgactccgagggcttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcgggcttcatccgcaacggcactcagagcatgtac
tgcatcccttgcgaaggcccttgccccaaagtctgtgaggaagaaaagaaaacaaagacc
attgattcagtcacttctgctcaaatgctccaaggatgcaccatcttcaagggcaatctg
ctcattaatatccgacgtggcaacaacatcgcttcggaactggagaacttcatggggctc
attgaggtggtgacgggctacgtgaagatccgtcactcccacgccttggtgtccttgtcc
ttcctgaagaacctgcgccagatcctaggagaggagcagctcgaggggaattactccttc
tacgtcctcgacaaccagaacttgcagcagctgtgggactgggaccaccgcaacctgact
atcaaagctgggaaaatgtactttgctttcaatcccaaattgtgtgtctccgaaatttac
cgcatggaggaggtgaccgggactaaagggcgccagagcaaaggggacataaacaccagg
aacaacggagagcgagcctcctgcgaaagcgatgtcctgcacttcacctccaccaccacc
tggaagaaccgcatcatcgtcacctggcaccggtaccggccccctgactacagggacctc
atcagcttcaccgtctactacaaggaggcaccctttaaaaacgtcacggagtatgacggg
caggatgcctgtggctccaacagctggaacatggtggatgtggacctccctcccaacaag
gacatcgagcctggcatcttactgcaggggctgaagccctggacgcagtatgctgtctac
gtcaaggccgtgaccctcaccatggtggagaacgaccacatccgtggggccaaaagcgag
atcttgtacattcgcaccaacgcttcagttccttccattcccctggatgttctctcagca
tcaaactcctcttctcagctgattgtgaagtggaacccgccctctctgcccaacggcaac
ctgagttactacatcgtgcggtggcagcgccagcctcaggacagctacctttaccggcac
aactactgctccaaaggtgaggacaaaatccccatcaggaagtatgctgatggcaccatc
gacgtcgaggaggtgacggagaatcccaagaccgaagtgtgtggtggcgagaaagggccg
tgctgcgcttgccccaaaaccgaggccgagaagcaggccgagaaggaggaggccgagtac
cgcaaggtcttcgagaattttctgcacaacgccatcttcgtgcccagacccgaaaggaag
cggagagaggtcatgcaggtcgccaacaccaccacgtccagccgaagcaggaacactacg
gtggtggacacctacaacatcacagacccagaagagctcgagacagagtaccctttcttt
gaaagcagagtggacaacaaggagagaaccgtaatctctaacctccggccttttactttg
taccgcatcgacatccacagctgtaaccacgaggctgagaagctgggctgcagtgcctcc
aactttgtctttgcgagaaccatgcctgcagaaggagcagatgacattcctggaccggtg
acctgggagccaaggcctgagaactccatctttttaaagtggccagaacctgagaatccc
aatggattgattctaatgtatgaaataaaatacggatcactcgtcgaggatcagcgggag
tgtgtgtctagacaggactacaggaagtatggaggggccaagctgaaccggctcaaccca
gggaactacacggcccggatccaggccacctctctctctgggaatgggtcgtggacggat
cctgtgttcttctacgtccaggccaaaacgacgtatgaaaatttcatccatctgatcatc
gccctgcctgttgccgtgctgttgattgtgggcgggttggttataatgttgtacgtcttc
cacaggaaaagaaataacagcaggctggggaacggagtgctgtatgcttcggtgaacccg
gagtacttcagtgcagccgatgtgtacgtgcctgacgagtgggaggtcgcccgggagaag
atcaccatgagccgagagctggggcagggctccttcggcatggtttacgaaggcgttgcc
aagggtgtggtcaaagatgagcctgagaccagggtggccattaagacggtgaacgaggcc
gcgagcatgcgcgagaggattgagtttctcaatgaggcctcagtgatgaaggagttcaac
tgtcaccacgtggtgcgcctgctgggcgtggtgtcgcagggccagccgacgctggtcatc
atggagctcatgacccggggggacctcaaaagttatctccggtctctgaggccagaaatg
gagaataacccagtcctagcacctccaagcctaagcaaaatgatccagatggctggagag
attgcagacggcatggcatacctcaacgccaataagtttgtccacagagacctcgctgcc
cggaactgcatggtggccgaagatttcacagtcaaaatcggagattttgggatgacgaga
gacatctatgagacagactattaccggaaaggagggaaagggctgctgcccgtgcgctgg
atgtcccccgagtccctcaaggatggagtcttcaccacgcactccgacgtctggtccttc
ggggtcgtcctctgggagatcgccacgctggccgagcagccataccagggcttgtccaac
gagcaagtccttcgcttcgtcatggagggtggccttctggacaagccggacaactgtcct
gacatgctgtttgagctgatgcgcatgtgctggcagtacaaccccaagatgaggccctcc
ttcctggagatcatcagcagcatcaaggacgagatggagcccggcttccgggaggtgtcc
ttctactacagtgaggagaacaagccgcccgaacccgaggagctggacctggagccggag
aacatggagagcgtccccctggacccctcggcctcctcgtcctccctgccgctgcccgaa
agacactcaggacacaaggccgagaacggccccggccccggcgtgctggtcctgcgagcc
agcttcgacgagagacagccttacgcgcacatgaacgggggccgcaagaacgaacgggcc
ctgcctctgccccagtcttcgacctgctga

DBGET integrated database retrieval system