KEGG   Camelus ferus (Wild Bactrian camel): 102524476
Entry
102524476         CDS       T02979                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04137  Mitophagy - animal
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04216  Ferroptosis
cfr04218  Cellular senescence
cfr04310  Wnt signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr05012  Parkinson disease
cfr05014  Amyotrophic lateral sclerosis
cfr05016  Huntington disease
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102524476 (TP53)
   04310 Wnt signaling pathway
    102524476 (TP53)
   04071 Sphingolipid signaling pathway
    102524476 (TP53)
   04151 PI3K-Akt signaling pathway
    102524476 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102524476 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102524476 (TP53)
   04210 Apoptosis
    102524476 (TP53)
   04216 Ferroptosis
    102524476 (TP53)
   04115 p53 signaling pathway
    102524476 (TP53)
   04218 Cellular senescence
    102524476 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102524476 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102524476 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102524476 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102524476 (TP53)
   05202 Transcriptional misregulation in cancer
    102524476 (TP53)
   05206 MicroRNAs in cancer
    102524476 (TP53)
   05205 Proteoglycans in cancer
    102524476 (TP53)
   05203 Viral carcinogenesis
    102524476 (TP53)
   05230 Central carbon metabolism in cancer
    102524476 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102524476 (TP53)
   05212 Pancreatic cancer
    102524476 (TP53)
   05225 Hepatocellular carcinoma
    102524476 (TP53)
   05226 Gastric cancer
    102524476 (TP53)
   05214 Glioma
    102524476 (TP53)
   05216 Thyroid cancer
    102524476 (TP53)
   05220 Chronic myeloid leukemia
    102524476 (TP53)
   05217 Basal cell carcinoma
    102524476 (TP53)
   05218 Melanoma
    102524476 (TP53)
   05219 Bladder cancer
    102524476 (TP53)
   05215 Prostate cancer
    102524476 (TP53)
   05213 Endometrial cancer
    102524476 (TP53)
   05224 Breast cancer
    102524476 (TP53)
   05222 Small cell lung cancer
    102524476 (TP53)
   05223 Non-small cell lung cancer
    102524476 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102524476 (TP53)
   05014 Amyotrophic lateral sclerosis
    102524476 (TP53)
   05016 Huntington disease
    102524476 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102524476 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102524476 (TP53)
   05161 Hepatitis B
    102524476 (TP53)
   05160 Hepatitis C
    102524476 (TP53)
   05162 Measles
    102524476 (TP53)
   05168 Herpes simplex virus 1 infection
    102524476 (TP53)
   05163 Human cytomegalovirus infection
    102524476 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102524476 (TP53)
   05169 Epstein-Barr virus infection
    102524476 (TP53)
   05165 Human papillomavirus infection
    102524476 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102524476 (TP53)
   01522 Endocrine resistance
    102524476 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102524476 (TP53)
   03036 Chromosome and associated proteins [BR:cfr03036]
    102524476 (TP53)
   03400 DNA repair and recombination proteins [BR:cfr03400]
    102524476 (TP53)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102524476 (TP53)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102524476 (TP53)
DNA repair and recombination proteins [BR:cfr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102524476 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 102524476
NCBI-ProteinID: XP_006175878
LinkDB
Position
16
AA seq 381 aa
MEESQSELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDELLLSPEVTNWLDENPDEA
PRMQEPPVPAAPAPATSWPLSSFVPSQKTYPGSYGFRLGFLHSGTAKSVTCTYSPPLNKL
FCQLAKTCPVQLWVSSLPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPIL
TIITLEDASGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQPCPELPPGSTKRALPTSS
SSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGENKAHSSHLKSK
KGQSPSRHKKLMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggaggagtcgcaatcagaactcggcgtggagccccctctgagtcaggagacgttttca
gacttgtggaaactgctacctgaaaacaaccttctgtcctctgagctctccccagcagtg
gatgaactactcctgtccccagaagttaccaactggttggatgagaatccagatgaagcc
ccaagaatgcaagagcctcctgtccccgctgcccccgcaccagccacctcctggcccctg
tcatcctttgtcccttcgcagaagacctaccctggcagctacggtttccgtcttgggttc
ctgcattctgggacagccaagtctgtaacctgcacgtactcccctcccctcaacaagctg
ttttgccagctggccaagacctgcccggtgcagctgtgggtcagctccctgcccccgccc
ggcacccgggtccgcgccatggccatctacaagaagtcagagtacatgacggaggttgtg
agacgctgcccccaccacgagcgcagctctgactacagcgatggtctcgcccctcctcag
catcttatccgggtggaagggaatttacgtgccaagtatttggatgacagaaacactttt
cgacacagtgtggtggtgccctacgaaccgccggaggtcggctctgactgtaccactatc
cactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcgacccatcctc
accatcatcacactggaggacgccagtggtaatctgctgggacgcaacagctttgaggtg
cgtgtttgtgcctgtcctgggagagaccgccgcacagaagaagaaaatttccgcaagaag
gggcagccttgccctgagctgccccctgggagcactaagcgagcactgcctaccagcagc
agctcctctccaccacaaaagaagaagccgctggatggagaatatttcactcttcagatc
cgcgggcgtgaacgtttcgagatgttccgggagctgaatgaggccttggagctgaaggat
gctcaggctggaaaggagccaggggaaaacaaggctcactctagccacctgaagtctaag
aaggggcagtctccctcccgccataaaaaactgatgttcaagagagaagggcctgactca
gactga

DBGET integrated database retrieval system