KEGG   Camelus ferus (Wild Bactrian camel): 102524547Help
Entry
102524547         CDS       T02979                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00020  Citrate cycle (TCA cycle)
cfr00190  Oxidative phosphorylation
cfr01100  Metabolic pathways
cfr01200  Carbon metabolism
cfr04714  Thermogenesis
cfr04932  Non-alcoholic fatty liver disease (NAFLD)
cfr05010  Alzheimer disease
cfr05012  Parkinson disease
cfr05016  Huntington disease
Module
cfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102524547 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102524547 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102524547 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102524547 (SDHB)
   05012 Parkinson disease
    102524547 (SDHB)
   05016 Huntington disease
    102524547 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102524547 (SDHB)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102524547 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102524547
NCBI-ProteinID: XP_006188320
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVAFSLRRRFPATTLGGACLQACRRAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcgttctccttgaggcgccggttcccggccacaaccctcggcggg
gcctgcctgcaggcttgccgcagggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaacctcatatgcaaact
tacgaaattgatttgaataactgtggccctatggtattggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcgtgcagagaaggtatctgcggctct
tgtgcgatgaacatcaacggaggcaacactctagcttgcacccgaagaattgacaccaac
ctcaacaaagtttcaaaaatctaccctctcccacatatgtatgtgataaaggatcttgtg
cctgatttgagcaacttctacgctcagtacaaatccattgagccttacctaaagaagaag
gacgagtcccaggaaggcaagcagcagtacctgcagtccatagaagatcgggagaaactg
gacgggctgtacgagtgcatcctgtgcgcctgctgcagcaccagctgccccagctactgg
tggaacggcgacaagtacctgggacccgcggtgctcatgcaggcctatcgctggatgatc
gactcccgggacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacgaagacctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggccacctataaggagaagaaagcctcagct
taa

DBGET integrated database retrieval system