KEGG   Collimonas fungivorans: CFU_0495Help
Entry
CFU_0495          CDS       T01583                                 

Gene name
gstA
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CFU_0495 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfu02000]
    CFU_0495 (gstA)
Enzymes [BR:cfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CFU_0495 (gstA)
Transporters [BR:cfu02000]
 Other Transporters
  Pores ion channels [TC:1]
   CFU_0495 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AEK60332
UniProt: G0AHQ4
LinkDB All DBs
Position
597591..598271
Genome map
AA seq 226 aa AA seqDB search
MPTMIIVHHLNNSRSQRVLWLLEELGLDYEIKPYQRDPKTMLAPPSLKAVHPLGKSPVIT
DGDNTIAESGAIIEYLVQQYGDGRFVPAAGSKERLRYTYWLHYAEGSAMPPLLMKLIFGR
LGRPPMPALLRPLARSIANGVQRNYIDPQLKAHLDFLESELGKSTWFAGEEFSAADIQMS
FPLEASQSRGGLDASRPRLFAFLQRIHARPAYQRAIEKGGKYDLLK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgccgaccatgatcatcgttcaccatctcaacaattcccgttcgcagcgcgtgctgtgg
ctgctcgaagagctggggctggattatgaaatcaagccctatcagcgcgatcccaaaacc
atgctggcgccgccgtcgctgaaggcggtccatcccttgggaaaatcgccggtcatcacc
gacggtgacaatacgattgccgaatccggtgcaatcatcgaatacctggtgcagcaatat
ggcgatggccgctttgtcccggctgcgggcagcaaggagcgcctgcgctacacctattgg
ctgcactatgccgaaggttcagccatgccgcctttgctgatgaagctgatcttcggccgc
ctgggccggccgccgatgccggccctgctacggccgttggcccgctcgatcgccaacggc
gtgcagcgcaattacatcgatccgcaactcaaggcgcacctggatttcctggaaagcgag
ctcggcaaatcgacctggttcgccggcgaagaattcagcgccgccgacatccagatgagc
tttccgctggaagcatcgcaatcacgcggcggcctggatgccagccgtcccaggctgttt
gctttcctgcagcgcatccatgcgcggccggcttaccagcgcgcgatcgaaaagggcgga
aaatacgatttgctcaagtaa

DBGET integrated database retrieval system