KEGG   Collimonas fungivorans: CFU_1215Help
Entry
CFU_1215          CDS       T01583                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfu  Collimonas fungivorans
Brite
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFU_1215 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEK61047
UniProt: G0AJB3
LinkDB All DBs
Position
complement(1425528..1426115)
Genome map
AA seq 195 aa AA seqDB search
MAHTLPPLPYDLDALAPHISKETLEFHYGKHHQTYVTNLNNLVPGTEFENATLEEIVKKS
SGGIFNNAAQVWNHTFYWNSLSPQSKGGGGAPTGALADAINAKWGSFDKFKEELTKTAVG
TFGSGWAWLVKNADGSLGLVSTSNAATPLTTDAKPLITVDVWEHAYYIDYRNARPKYLEA
FWALANWEFASKNFA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcacacacactcccgcctctcccgtacgatctggacgcactggctccgcacatctcc
aaggaaaccctggaattccactatggtaaacatcaccagacctatgtgaccaacctgaac
aacctggttccgggcacagaattcgaaaacgctactctggaagagatcgtcaagaaatct
tccggcggcattttcaacaatgcagcgcaagtctggaaccatactttctactggaacagc
ctttcgccgcaaagcaaaggcggcggcggcgcaccaaccggcgcattggcagatgcgatc
aatgcaaaatggggttcgttcgacaagttcaaggaagaactgaccaagaccgcggtcggc
actttcggctccggctgggcatggctggtgaagaatgctgacggttcgctcggcctggtg
tcgacttccaatgcagccactccgctgaccaccgacgccaaaccgctgattactgtcgac
gtctgggaacatgcttactacatcgactaccgcaacgcccgtccaaaatacctggaagca
ttctgggcattggcgaactgggaatttgcttcgaagaatttcgcataa

DBGET integrated database retrieval system