KEGG   Collimonas fungivorans: CFU_1281Help
Entry
CFU_1281          CDS       T01583                                 

Definition
(GenBank) putative amino acid ABC transporter, periplasmic-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
cfu  Collimonas fungivorans
Pathway
cfu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CFU_1281
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfu02000]
    CFU_1281
   02035 Bacterial motility proteins [BR:cfu02035]
    CFU_1281
Transporters [BR:cfu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    CFU_1281
Bacterial motility proteins [BR:cfu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    CFU_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AEK61113
UniProt: G0AJH9
LinkDB All DBs
Position
complement(1501925..1502728)
Genome map
AA seq 267 aa AA seqDB search
MATTLSKLSKIAAAVLIAGVTLNAFAADLLDTVKTRGTLKVAMEGNYPPFNFKDPKSGEL
TGFEVDVAKLLAAKLGVKPEFTTTEWSGILAGLGAGKYDVILNQVGITEARQKAFDFSQP
YTLSTAQLIVRKDEKRSFPTLESLKGYKLGLGQGTNFEQKAKAVAGIDVKTYPGSPEYLA
DLASGRIDAALNDRLLVGYLLKSSNLPLKAGATFGDIDKIGIPFQKGNPKFEAALNKALD
EILKDGSFKQVSFKWFGFDVSKAPSAQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacactgtccaaactgagcaagattgcagcagcggtactgatcgccggagtc
acgctcaatgcgttcgcagcagacctgctggataccgtcaaaacccgcggcaccctgaaa
gtagcgatggaaggcaactatcccccgttcaatttcaaggacccgaaaagcggcgagctg
accggctttgaagtcgacgtcgccaaactgctggcggccaagcttggggtcaagccggaa
ttcaccaccaccgagtggagcggcatcctggcgggcctcggcgccggcaaatacgacgtc
atcctgaaccaggtcgggattaccgaagcgcgccagaaagccttcgatttttcgcagcca
tacaccttgtcgaccgcgcagctgattgtccgcaaagacgagaagcgcagcttccctact
ctggaatcgctgaagggctacaagctcggcctgggccagggcaccaactttgagcaaaaa
gccaaggcggttgcgggcatcgatgtcaaaacctatcccggttcgcctgaatacctggcc
gacctcgccagcggccgcatcgatgcagccttgaacgaccgcctgctggtcggctatctg
ctgaagagctccaacctgccgctgaaagccggcgccacctttggcgacatcgacaagatc
ggcatccctttccagaaaggcaatccgaaattcgaggcagcgctgaacaaagcgctcgac
gaaatcctgaaagacggcagtttcaagcaagtgtccttcaagtggttcggtttcgatgtt
agcaaagcgccatcggcgcaatga

DBGET integrated database retrieval system