KEGG   Collimonas fungivorans: CFU_1409Help
Entry
CFU_1409          CDS       T01583                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00620  Pyruvate metabolism
cfu00680  Methane metabolism
cfu01100  Metabolic pathways
cfu01120  Microbial metabolism in diverse environments
cfu01200  Carbon metabolism
Module
cfu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFU_1409 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CFU_1409 (ppc)
Enzymes [BR:cfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFU_1409 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEK61241
UniProt: G0AJM6
LinkDB All DBs
Position
complement(1659293..1662166)
Genome map
AA seq 957 aa AA seqDB search
MAKQLNSAVQVKKPAPNKDAPLKEDIRLLGRLLGDVLRDQEGDAVFEVVETIRQTAVRFR
RESDPQAGADLDKLLKKLTRDQTNSVVRAFSYFSHLANIAEDQHHNRRRRAHLLAGSAAQ
PGSVAHALSKLDDAGVSGATVRSFLKDALISPVLTAHPTEVQRKSILDAEREIARLLAER
DRPLTAKELRDNTELLRGRIATLWQTRMLRYTKLTVADEIENALSYYRITFLRELPALYD
DIEGEIATQFPTRARQPSGGANAELAPFVQMGSWIGGDRDGNPNVNAGTMQRALSRQSTT
IFDFYLEEVHALGAELSVSTLMVSVNQELLALAESSPDTSDHRSDEPYRRALIGIYARLA
STARELGATNILRQEVGAAAHYATPQEFTQELQIVEDSLRAHHGSALVKPRLATLKRASE
IFGFHLASLDMRQSSDVHERVLTELFAQAQVEGAYDKLSEEQKIDLLLAELAKPRLLYSP
YIEYSDETVSELSILRAAGEMRQRYGARSIRNYIISHTETVSDLLEVLLLQQETGLLRPD
AVAGKGKAAVGELEVMVIPLFETIPDLRRAAAIMEQFMALAPVERLIAKQGKLQEVMLGY
SDSNKDGGFLTSNWELYKAEIQLVRVFDRAGVKLRLFHGRGGTVGRGGGPSYQAILAQPP
GTVNGQIRLTEQGEIIASKFSNPEIGRRNLELLVAATLEASLMPNNADARQTKKLGEFEQ
LMDGLSERAYQSYRNLVYETPGFTDYFFAATPIAEIAELNIGSRPASRKSTRRIEDLRAI
PWGFSWGQCRLLLPGWYGFGSAIESWLEEGKDSKLKTQKLATLRAMYKEWPFFATLLSNM
DMVLSKTDLAVASRYAGLVTDRKLRNSIFKRIVDEHERTSSILSAITGSKDRLSGNPLLA
RSIKNRFAYLDPLNHLQVELIKRHRSVTAAGRTTEERVKRGIHLSINGIAAGLRNTG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaattgaattctgctgtccaggtaaaaaaacccgctcccaataaagatgct
ccgctcaaagaagatatccgtctgctgggccgcttgctgggcgacgtgctgcgcgatcag
gagggcgacgcggtatttgaagtggtggaaaccatacgccagacggcggtacgcttccgg
cgcgaatcggatccgcaggccggcgccgacctcgacaagctgctcaagaaactcacgcgc
gaccagaccaattcggtggtgcgcgcattttcctatttctcgcacctggccaatatcgcc
gaggatcagcaccataaccggcgccgccgcgcccacttgctggccggatcggcagcccag
cccggcagcgtggcgcatgccctgagcaagctggatgacgccggcgtctccggcgccacc
gtgcgcagcttcctgaaagatgccttgatttcgccggtcctgactgcccacccgaccgaa
gtgcagcgcaagagcatcctcgatgcggagcgcgagatcgcccgcctgctggccgagcgc
gaccgtcccctgaccgcgaaagaactgcgcgacaacaccgaactgctgcgcggccgcatc
gccaccctgtggcaaacccgcatgctgcgctataccaagctgacggtagcggacgaaatc
gagaatgccctgtcctactaccgcatcaccttcctgcgcgaactgccggcgctgtatgac
gacatcgaaggcgaaatcgccacccagttcccgacccgcgcgcgccagcccagcggcggc
gccaatgccgaactggcgcccttcgtgcagatgggtagctggatcggcggcgaccgcgac
ggcaatcccaacgtcaacgccggcaccatgcagcgcgcgctgtcgcggcaatcgaccacc
atctttgatttttacctggaagaagtacatgcgctgggcgcggagctgtcggtctcgacc
ctgatggtcagcgtcaaccaggaactgctggcgctggcggaaagttcgcccgacacctcg
gaccatcgttccgacgaaccttaccgccgcgccctgatcggcatctacgcacggctggcc
tcgaccgcgcgcgagctgggcgccaccaacatcctgcgccaggaagtcggcgccgccgcc
cactatgcgacgccgcaggaatttacccaggaattgcagatcgtcgaagattcgctgcgc
gcccaccacggcagcgcactggtcaagccgcggctggcgacgctcaagcgcgcttccgag
attttcggtttccacctggcctcgctcgacatgcgccagagttccgacgtccacgaacgg
gtgctgaccgagctgttcgcccaggcccaggtggaaggcgcttacgacaagctcagcgaa
gaacagaagatcgacctgctactggccgaactggccaagccgcgcctgctgtactcgccg
tacatcgagtattccgacgagaccgtgtccgaactgtcgatcctgcgcgccgccggcgag
atgcgccagcgctacggcgcgcgctcgatccgcaactacatcatctcgcacaccgagact
gtgtccgacttgctggaagtcctgctgctgcaacaagaaaccggcctgctgcggcctgat
gccgttgcgggcaagggcaaggctgccgtcggcgagctggaagtcatggtgatcccgcta
ttcgaaaccattcccgacctgcgccgcgccgccgccatcatggagcagttcatggccctg
gcgcctgtggagcggctgatcgccaagcaaggcaagctgcaggaagtgatgctgggttat
tccgactccaacaaggacggtggtttcctgacttccaactgggagctgtacaaggctgag
atccagctggtgcgcgtattcgaccgcgccggcgtcaagctgcgcctgttccatggccgc
ggcggcaccgtcggccgcggcggcggcccgagctaccaggcgatcctggcgcagccgccg
ggcaccgtcaacggccagatccgcctgaccgagcaaggcgagatcatcgcttccaagttt
tccaacccggaaatcggccgccgcaacctggagctgctggtggcggcgacgctggaagcg
agcctgatgcctaacaatgccgacgccaggcaaaccaagaagctaggcgaattcgaacag
ctgatggatggtttgtcggaacgcgcttaccagtcctaccgcaacctggtctatgaaacc
cccggtttcaccgactacttctttgcggcgacgccgattgccgagatcgccgaactgaac
atcggttcgcgccctgcctcgcgcaaatcgacgcgccgcatcgaagacttgcgcgcgatt
ccctggggcttttcctggggccagtgccgtttgctgctgccgggctggtacggcttcggc
agcgccatcgaaagctggctggaagagggaaaggacagcaagctcaagacccagaagctg
gcgaccttgcgcgccatgtacaaggaatggccgttcttcgccaccctgctgtcgaacatg
gacatggtgctgtcgaagaccgacctggctgtggcctcgcgctatgccgggctggtcacc
gaccgcaagctgcgcaacagcatcttcaagcgcatcgtcgatgaacacgagcgcaccagc
agcatcctgtcggccatcaccggctccaaggaccgcctgtcgggcaatccgctgctggcg
cgttcgatcaagaaccgcttcgcctacctcgatccgctgaaccacttgcaggtggaactg
atcaagcgccaccgcagcgtgaccgcggccggccgcacgacggaagaaagggtcaaacgc
ggcatccacctgagcatcaacggcatcgccgccggtttgcgcaatacgggttga

DBGET integrated database retrieval system