KEGG   Collimonas fungivorans: CFU_1655Help
Entry
CFU_1655          CDS       T01583                                 

Gene name
aldA
Definition
(GenBank) Aldehyde dehydrogenase; Acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00010  Glycolysis / Gluconeogenesis
cfu00620  Pyruvate metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_1655 (aldA)
   00620 Pyruvate metabolism
    CFU_1655 (aldA)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CFU_1655 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AEK61487
UniProt: G0A8L4
LinkDB All DBs
Position
complement(1943148..1944668)
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLATRNPFKQRYDNFIGGKFVAPVKGEYFENVSPVIGKTFCEIARSGAEDIEL
ALDAAHAAKAAWGKTSPAERANILNKIADRMEANLELLAIAETIDNGKPIRETTAADIPL
AIDHFRYFAACIRAQEGSVATIDDQTYAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVWIELVQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNVFFADVMDQDDAFFDKCLEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVKAIKQGNPLDSATMIGAQASQEQLEKILSYIDIGK
QEGAKLLTGGVRKQLGGDFDAGYYVEPTVFEGNNKMRIFQEEIFGPVLSVTTFKDEEEAL
ALANDTLYGLGAGLWTRDGSRAFRMGRGIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgcagacatcagcaagctagccacccgcaatccattcaagcaacgttacgac
aatttcatcggcggcaagttcgtggcgccggtcaagggcgaatatttcgaaaacgtcagc
ccggtcatcggcaagactttctgtgaaatcgcccgttccggcgccgaggacatcgaactg
gcgctggacgcggcgcacgccgccaaagccgcctggggcaagacctcgccggcggaacgc
gccaacatcctgaacaagatcgccgaccgcatggaagccaacctggaattgctggcgatt
gccgaaaccatagacaacggcaagccgatacgcgaaaccacggccgccgacatcccgctg
gcgatcgaccatttccgttatttcgccgcctgcatccgggctcaggaaggttcggtcgcc
accatcgacgaccagacctatgcctatcacttccacgagccgctgggtgtggtgggccag
atcatcccatggaatttcccgatcctgatggcggtctggaaactggcgccggcgctggcc
gccggcaattgtgtggtgctgaagccggccgagcagacgccggcctcgatcatggtctgg
atcgagctggtgcaagacctgctgccgcccggcgtgctcaacattgtcaacggcttcggc
ctggaagccggcaagccgctggcctccagcaagcgcatcgccaagatcgccttcaccggc
gaaaccaccaccggccgcctgatcatgcagtatgcttcgcaaaacatcatcccggtgacg
ctggagctgggcggcaaatcgccgaatgtattcttcgccgacgtgatggaccaggacgac
gcgtttttcgacaagtgcctggaaggtttcgccatgttcgccttgaatcagggtgaagtc
tgcacctgcccgtcgcgcgcgctgatccaggaatcgatctacgaccgtttcatggagcgt
gcgctgaaacgggtcaaggccatcaagcaaggcaatccgctcgacagcgccaccatgatc
ggcgcccaggcttcgcaggagcaactggaaaaaatcctgtcctacatcgacatcggcaag
caggaaggcgccaagctgctcaccggcggcgtgcgcaagcagctgggcggcgatttcgat
gccggctactacgtcgaaccgacagtcttcgaaggcaacaacaagatgcgcatcttccag
gaagaaatcttcggcccggtgctgtccgtcaccaccttcaaggatgaagaagaagcgctg
gcgctggccaacgacaccttgtacggcctcggcgcaggcttgtggacccgcgacggttcg
cgcgccttccgcatgggacgcggaatccaggccggccgggtatggaccaattgctaccac
ctgtatccggcccatgccgcattcggcggctacaagcagtccggcataggccgcgaaaac
cacaagatgatgctggatcattaccagcaaaccaagaacctgctagtcagctacagcccg
aacgcactgggctttttctaa

DBGET integrated database retrieval system