KEGG   Collimonas fungivorans: CFU_3077Help
Entry
CFU_3077          CDS       T01583                                 

Gene name
maeB2
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00620  Pyruvate metabolism
cfu01100  Metabolic pathways
cfu01120  Microbial metabolism in diverse environments
cfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFU_3077 (maeB2)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     CFU_3077 (maeB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: AEK62902
UniProt: G0ACM8
LinkDB All DBs
Position
complement(3614922..3617231)
Genome map
AA seq 769 aa AA seqDB search
MSTPTTLSAAEQALRDAALEYHRSPTRGKIAVVPTKPLSNQRDLSLAYSPGVAYACLAIH
EDPEMAVEYTSRANLVGVVTNGTAVLGLGDIGPLAGKPVMEGKGCLFHNFAGIDVFDIEL
AERDPDKLVEIIAALEPTLGGINLEDIKAPECFYIEKKLRERMKIPVFHDDQHGTAIISS
AALLNGLELVNKKIGEVKLVASGAGAAAIACLDLMVELGVKRENIFVCDSRGVIHDKRED
KLDVSKQRYQQTTNARTLADAIVDADVFLGCSAPGVLSQDMVKAMGSQPIILALANPEPE
IRPELALEARPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATSITEAMKVACVREIA
DLTKAEISEEVASAYAGQELHFGPEYIIPKPFDSRLILRIAPAVARAAEESGVATRPIKD
MEAYRQSLMRFVSHTGMFMRPVFVAARGEPQRIVYAEGEDERVLRAVQIALEEKLVRPIL
IGRPAVIEARIKRAGLRLQAGRDFELINPEDDVRFRQYWETYHEIKARDGVTPEMAKSTL
RRSNTTIASLLVKLGDADGMLCGLVGRFDNHLEHVSDIIGLRDGAKCFATMNGLVLDKHT
LFIADTFVNDDPDAEQLADIAAMAVEEVRRFGVPPKVAFLSHSMFGSSTRPSAKKMRAAR
DLFVKRMPDVEADGEMHGDAALSAEVRAQFLPKSTLSGDANVLVTPNLDAANILFNVLKM
TGGQGVTVGPVLLGAAAPVHILNPSATVRRVVNMTALVVANAISAKQGV
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccaaccactctttctgcggccgagcaggccctgcgcgacgcggcgctggaa
tatcaccgcagcccgacgcgcggcaagatcgccgtggtgccgaccaagcccctgtcgaac
cagcgcgacctgtcgctggcgtattcgcccggcgtggcctatgcctgcctggcgatccac
gaagatccggaaatggcggtggaatatacctcgcgcgccaacctggtgggcgtggtcacc
aacggcaccgcggtgctgggcctgggcgacatcgggccgctggccggcaagccggtaatg
gaaggcaagggttgcctgttccataatttcgccggcatcgatgtgttcgacatcgaactg
gccgagcgcgacccggacaagctggtcgagatcatcgccgcgctggagccgaccctgggc
ggcatcaacctggaagacatcaaggcgccggaatgcttctatatcgaaaagaagctgcgc
gagcgcatgaagatcccggtcttccacgacgaccagcacggcaccgccatcatttcctcg
gcggccctgctgaacggcctggagctggtcaacaagaagatcggcgaagtcaagctggtg
gcgtccggcgccggcgccgcggcgatcgcctgcctcgacctgatggtcgagctgggcgtc
aagcgtgaaaacattttcgtctgcgactcgcgtggcgtgatccatgacaagcgcgaagac
aagctggatgtatccaagcagcgctaccagcagaccaccaatgcccgcaccctggccgat
gcgattgtcgatgccgacgtgttcctcggctgctcggcgcccggcgtgctgagccaggac
atggtcaaggccatgggttcgcagcccatcatcctggcgctggccaatccggaaccggaa
atccgccctgagctggcgctggaagcgcggccggactgcatcatcgccaccggccgttcg
gattatccgaaccaggtcaacaacgttttgtgtttcccttacattttccgcggcgccctg
gactgcggcgccaccagcatcacggaagcgatgaaggtcgcctgcgtacgcgagatcgcc
gacctgaccaaggccgagatcagcgaggaagtggcgtccgcctatgccggccaggaactg
catttcggcccggaatacatcattccgaagccattcgattcgcgcctgatcctgcgcatc
gcgcctgcggttgcgcgcgccgccgaagagtcgggggtggcgacgcgtccaatcaaggac
atggaagcttaccgccagtcgctgatgcgttttgtcagccataccggcatgttcatgcgt
ccggtgtttgtcgccgcgcgcggcgagccgcaacgcatcgtctacgccgagggcgaggac
gagcgcgtattgcgggcggtgcagatcgcgctggaagaaaagctggtgcggcccatcttg
atcggccgtccggcggtgatcgaggcgcgcatcaagcgcgccggcttgcgcttgcaggcc
ggacgcgatttcgaactgatcaatccagaagacgatgtgcgtttccgccagtactgggaa
acctatcacgagatcaaggcgcgcgacggcgtcacgcccgagatggcgaagtcgaccttg
cgccgttccaacaccaccattgcgtcgctgctggtcaagctgggcgacgccgacggcatg
ctgtgcggcctggtcgggcgtttcgacaaccacctggaacatgtgagcgacatcatcggc
ctgcgcgacggcgccaagtgcttcgccaccatgaacggcctggtgctggacaagcatacc
ttgttcatcgccgataccttcgtcaacgacgatccggatgccgagcagctggccgatatc
gcggcgatggcggtggaagaggtgaggcgcttcggcgtgccgcccaaggtggcgttcctg
tcgcactcgatgttcggttccagcacgcggccgtcggccaagaagatgcgcgccgcgcgc
gacttgttcgtcaagcgcatgccggatgtcgaagccgatggcgagatgcacggcgacgcg
gccctgagcgcagaggtaagggcgcagttcctgccgaaatcgacgctgagcggcgacgcc
aacgtgctggtgacgcctaacctggacgccgccaatatcttgttcaacgtgttgaagatg
accggcggccagggcgttacggtgggaccggtattgctgggcgccgcggcgccggtgcat
atcctgaacccgtcggcgacggtgcgccgggtggtcaacatgacggcgctggtggtggca
aacgctatctctgccaagcagggagtgtaa

DBGET integrated database retrieval system