KEGG   Collimonas fungivorans: CFU_4227Help
Entry
CFU_4227          CDS       T01583                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00473  D-Alanine metabolism
cfu01100  Metabolic pathways
cfu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFU_4227 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CFU_4227 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfu01011]
    CFU_4227 (alr)
Enzymes [BR:cfu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CFU_4227 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cfu01011]
 Precursor biosynthesis
  Racemase
   CFU_4227 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEK64048
UniProt: G0AEB8
LinkDB All DBs
Position
4930380..4931489
Genome map
AA seq 369 aa AA seqDB search
MQPQAAHAGAILTVDLGALRSNYRLLRKQAGSALCGAAVKADAYGLGAARVGPALAAEGC
RHFFVAHLDEGIALRPHLPATAQIFVLHGPPPGAEQEFISHGLLPVLNSLQQIQGWHALA
QMLQRPLPAIVQVDSGMSRMGLPAAEAEAWLADPRYLQTIPPLFLMSHLACAEHQDHPMN
ASQLARFNTLRQRLLQVPASLANSSGIFLGSDYQFDLVRPGAALYGIAPVAGAANPLQPV
AALHGRILQTRSIERGDHVGYGISYSATEQRQIATVGVGYADGWLRGMSNRGLVFIDGRA
VPMVGTVSMDSITIDVTGIAAERLQAGALVELIGPHRPVDDVARLAGTIGYEILTGLGHR
YHREYIGGL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctcaagcggcacacgcaggcgctatcctgacggtcgacctcggcgccctgcgc
agcaactatcgcctgctgcgcaagcaagccggatcggcactatgcggcgcggccgtcaag
gccgacgcctacggcctgggcgcagcacgggtcggaccggcgctggcggcggaaggctgc
cgccacttttttgtcgcccatctcgacgagggcattgcgctgcggccgcatttgccggcc
accgcacagatattcgtattacacgggccgccgcccggcgcagagcaggaattcatcagc
cacggcctgctgccggtgctcaacagcctgcagcagatccagggctggcacgcgctggcg
caaatgctgcagcggccattgccggccatcgtccaggtcgacagcggcatgtcgcgcatg
ggattgccggcggccgaagccgaagcctggctggccgatccgcgttacctgcaaaccatc
ccgccgctgttcctgatgagccacctggcttgcgccgaacaccaggaccatccgatgaac
gccagccagctggcgcgcttcaatacattgcgccagcgcttgctgcaagtgccggccagc
ctggccaactcttccgggattttcctcggcagcgactaccagttcgacctggttcgtccg
ggcgcagccttgtacggcatcgcgccggtggccggcgccgccaatccgctgcagccggtg
gccgccctgcacggccgcatcctgcaaacccgtagcatcgaacgcggcgaccatgtcggc
tacggcatcagctacagcgccaccgaacaacggcagatcgccaccgtcggcgtcggttac
gccgacggctggctgcgcggcatgagcaaccgcggcctggtgttcatcgacggccgggcg
gtgcctatggtcggcaccgtctccatggattcgatcaccatcgatgtcaccggcatcgcc
gccgagcggctgcaggccggcgccctggtcgaactgatcggcccgcaccgtccggtcgac
gacgtcgcgcggctggccggcaccatcggctacgaaatcctgaccggcctcggccaccgc
tatcaccgcgaatacatcggcggattgtag

DBGET integrated database retrieval system