KEGG   Cystobacter fuscus: CYFUS_000767Help
Entry
CYFUS_000767      CDS       T05065                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00380  Tryptophan metabolism
cfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CYFUS_000767
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     CYFUS_000767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ATB35355
UniProt: A0A250IUB9
LinkDB All DBs
Position
908574..909845
Genome map
AA seq 423 aa AA seqDB search
MSGEFEPGEAFARRMDAEDPLRSFREEFLFPVHGDGHELYLLGNSLGLQPRKAREYVLAA
MEDWARLGVDGHFKGSPPWMEFHVGLGEQMARVVGARPEEVVVMNTLTVNLHLMMVSFYR
PTPERSKILMEASAFPSDQYAVAAQVRHHGYAPERTVIPLAPRPGEETLRHEDILDTLER
HGKEIALVLLGNVNYLTGQAFDMAAITRAAHRQGCRVGFDLAHAAGNLRLSLHEDGPDFA
VWCSYKYLNGGPGALGGVFIHERHLRDASLHRLPGWWGNDRGTRFQMKPDFEPAPGAEGW
VLSNPPIIQMAALRASLELFDRATMPALRAKSEKLTGYLEFLIDRLPEGFVRSLTSRDPG
QRGAHLSLRFTKDPQRMLETLRAEGIHCDFRYPDIIRAAPVPLYNSFLDVHRFVSVLERY
ARG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtgagttcgagcccggcgaggcgttcgcccggcgcatggacgcggaggatccg
ttgcgctccttccgcgaggagttcctctttcccgtccatggtgacgggcacgagctgtac
ctgctgggcaactccctgggccttcagccgcgcaaggcgagggagtacgtgctggcggcc
atggaggactgggcgcggctgggcgtggacggccacttcaagggctcgccgccgtggatg
gagttccacgtcggcctgggcgagcagatggcgcgggtggtgggcgcgcggcccgaggaa
gtggtggtgatgaacaccctcacggtgaacctgcacctgatgatggtgtccttctaccgg
cccactcccgagcgctcgaagatcctcatggaggcgagcgcctttccctcggaccagtac
gcggtggccgcgcaggtgcgccaccacgggtacgcgccggagcggacggtgattccgctc
gcgccccgcccgggggaggagacgctgcgccacgaggacatcctcgacacgctggagcgg
cacgggaaggagatcgccctggtgctgctgggcaacgtgaactacctcaccggccaggcc
ttcgacatggcggccatcacccgcgcggcgcaccggcagggctgccgggtggggttcgat
ctggcgcacgccgcgggcaacctgcggctgtccctgcacgaggacgggccggacttcgcc
gtgtggtgctcgtacaagtacctcaatgggggcccgggcgcgctgggcggtgtcttcatc
cacgagcgccacctgcgcgatgcgtccctgcaccggctgccgggctggtggggtaacgac
aggggcacgcgcttccagatgaagccggacttcgagcccgcgccgggcgccgagggctgg
gtgctgtccaatccgcccatcatccagatggcggccctgcgcgcctcgctggagctcttc
gatcgcgcgacgatgccggccctgcgcgccaagagcgagaagctcacgggctacctggag
ttcctcatcgaccggctcccggagggcttcgtgcgcagcctcacgtccagggatccggga
cagcgcggcgcccacctgtcgctgcgcttcacgaaggatccccagcgcatgctggagacg
ctgcgcgcggagggcatccactgcgacttccgctacccggacatcatccgcgccgcgccc
gtgcccctctacaacagcttcctggacgtccaccgcttcgtgagcgtgctcgagcgctac
gcgcgcggctga

DBGET integrated database retrieval system