KEGG   Cystobacter fuscus: CYFUS_001907Help
Entry
CYFUS_001907      CDS       T05065                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00052  Galactose metabolism
cfus00511  Other glycan degradation
cfus00600  Sphingolipid metabolism
cfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CYFUS_001907
  Lipid metabolism
   00600 Sphingolipid metabolism
    CYFUS_001907
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CYFUS_001907
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CYFUS_001907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 F5_F8_type_C Cellulase Big_1
Motif
Other DBs
NCBI-ProteinID: ATB36492
UniProt: A0A250IZ31
LinkDB All DBs
Position
2314480..2317641
Genome map
AA seq 1053 aa AA seqDB search
MGRNAPGMWAAWLVCLGLGCVANQPVPPKGEEPTPPATDQSPGRRVDFDRDWKFVLVNPE
GITDPSGSYATAHEPSFDDSSWRKLNVPHDWSIERDPSPGPGTTSGTGFFQGGLGWYRKT
FTLPSSMAGKKLSIEFDGVYMDSYVYVNGELVGNHPYGYTAFDVDLSSRVYTDGVTPNVI
AVKVQNQLPSSRWYSGSGIYRHVHLTVTDPIHVVRWGTFVTVPELEKTVGEGYANVRVQT
DVVNEGGTPKDVEVRSLVKDANGKVVAQVTSLATALGPAPQRLTATLRVEHPTLWSLANP
YRYTLETALVSEGKEVDTTSTRFGMRYFRIDPNEGFSLNGESTKIQGVDLHHDLGALGAA
VHRDALVRQMTIMKSMGVNALRTAHNPPAPELIDICEEMGIVMLVEAFDSWRTGKNPYDY
GRFFDEHSDADIKEMVNAAKNSPAVIMWSIGNEIPDSTSEAGLAMAQRLVEDIKSIDTSR
PIVIGSDKYRRVPAPESPAARILGLLDGLGLNYNTAKSVDGLRAAFPGKFLFESESSSET
STRGVYQDPHLLNTGENYTPGKRGTSSYDNNLASWTMSGEYGLKKDRDRKFFAGEFLWSG
IDYIGEPTPYDVYPVKASFFGAVDTAGFPKDMYYLFKSQWTQEPMVHLLPMNWTDHAPGQ
PVAVWAYANVDTVELLLNGQSLGERKFSHKKTLDGRAYLETDEATGDDKTFTSGPFPGSY
TSPNGSAGKLHLSWSVPFAPGELVAVAKKDGVEVARDVLRTAGAPNTLRLTPDKTVITAD
GKSLVFVTAEVVDSKGVMVPSAANLIHFQVTGGALVGADNGRQESAENYKASSRTAFNGK
ALAIIQSSVTSGPITVTASSDGLTPGSTTIVSEGGSGSVAGSAATSTPVGPARSVGTVPA
ADPEIPTADASYSGSPQSVPAAMLDGNKTSGGWSNFYEKAATALLPAVSQANASDWVSLK
WPQARSLDSVTAWFTTGAKRVLPASLVVTYWDGKGYVPVSHPSISWASASNQPTVISFDP
VQTTELRLEMTSPAPGSATGFLQISELEVPVSR
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggaatgcgccaggaatgtgggctgcctggctggtgtgtctgggactgggatgt
gtggcgaaccagccggtgcccccgaagggcgaagagcctactccccctgccacggatcag
agccctggcaggcgtgtggacttcgacagggattggaagttcgtcctggtcaaccccgag
ggaatcaccgacccgagcggttcctatgcgaccgcgcatgagccgtctttcgatgactcg
tcgtggaggaagctgaatgttcctcacgactggagcatcgagcgggaccccagcccgggg
ccggggaccaccagtgggacgggcttcttccaggggggtctgggctggtaccggaagact
ttcaccctcccgtcgtcgatggcgggaaagaagctctccatcgaattcgatggcgtgtac
atggactcctacgtctatgtgaatggtgaactggtgggcaaccacccctatggctacacc
gccttcgacgtggacctgtcctcccgggtgtacacggatggggtgacgcccaacgtcatc
gccgtgaaggtccagaaccagcttccgagcagccggtggtactccggcagtggcatctac
aggcacgtccacctgacggtgacggaccccatccacgtggtgcgttggggcaccttcgtc
accgtcccggaactcgagaagacggtgggagagggctacgcgaacgtccgcgtgcagacc
gacgtggtcaacgagggcggcaccccgaaggacgtagaggtccgctccctggtgaaggac
gccaacgggaaggtcgtggcgcaggtcacgtcactcgccaccgcgctgggcccggcgccc
cagcggctcacggccaccctccgggtcgagcaccccacgctctggtcgttggcgaatccc
taccggtacaccctggaaaccgccctcgtctccgagggcaaggaggtggacaccacctcc
acccgcttcggcatgcggtatttccgcatcgatcccaacgagggcttctcgctcaacggc
gagtccacgaagatccagggagtcgatctgcaccatgatctcggcgccctgggggcggcc
gttcaccgcgatgccctggtgcggcagatgacgatcatgaagagcatgggggtcaacgcc
ctcaggaccgcgcacaacccgcctgctcccgaactgatcgacatctgcgaggagatgggc
atcgtcatgctggtggaggccttcgactcctggaggaccgggaagaacccgtatgactac
gggcgcttcttcgatgagcacagtgatgccgacatcaaggagatggtgaacgccgccaag
aactctcccgcggtcatcatgtggtccattggcaacgagattccggattcgacctcggag
gcgggtctggcgatggcccagcgactggtcgaggacatcaagtccatcgacacctcccgg
cccatcgtcatcggctcggacaagtaccggcgcgtgcctgctccggagtcgccggccgcg
cgcatcctcgggctgctggatggcctgggtctgaactacaacacggcgaagtcggtggat
gggctccgggccgcgtttccgggcaagttcctcttcgagtcggagtcctcgtcggagacg
tccacccggggcgtgtaccaggacccccacctgctgaacaccggtgagaactacaccccg
ggcaagcggggcacgtcctcctacgacaacaacctggcctcctggaccatgagtggggag
tacggcctgaagaaggaccgggaccggaagttcttcgccggcgagttcctctggtcgggc
atcgactacatcggcgagccgaccccgtacgacgtctatcccgtgaaggcctcgttcttt
ggcgccgtggacacggccggcttccccaaggacatgtattacctgttcaagagccagtgg
acccaggagcccatggtccatctgcttcccatgaactggacggaccacgcgcctggccag
cccgtggctgtctgggcctatgccaatgtcgatacggtggagctgctcctgaacggccag
tccctgggcgagcggaagttcagccacaagaagaccctggatggccgggcgtatctggag
acggacgaggccaccggtgacgacaagacattcacctcgggccccttcccgggcagctac
accagtcccaatggcagtgccggcaagctgcacctgtcctggagcgtgccgttcgcgccg
ggagagctggtggcggtcgccaagaaggacggcgtggaggtggcccgggacgtgctgcgg
accgccggagcgccgaacaccttgaggctgaccccggacaagacggtcatcaccgcggac
ggcaagtcgctggtgttcgtgacggccgaggtcgtggactcgaagggggtgatggttccc
agcgccgcgaacctgattcacttccaggtgacgggcggagccctggtgggcgccgacaac
gggcgtcaggagagcgcggagaactacaaggcctcttcccggacggccttcaacggcaag
gcgctggccatcatccagtccagcgtcacctccgggcccatcaccgtcaccgcgtcatcg
gacgggctgactccgggctccacgacgattgtctccgagggcgggagtggttccgtggct
ggctccgcggcgacctcgactccggtgggcccggccaggagcgtggggaccgtgccggca
gcggatccggaaatccccaccgctgacgcgagctactcgggctctccccagtcggtgccc
gcggcgatgctcgacgggaacaagacctcggggggctggtcgaacttctatgagaaggcg
gccaccgcgctcctgcccgcggtgagccaggccaacgcgtcggactgggtctcgctcaag
tggccccaggcgcggtccctcgattccgtgacggcctggttcacgaccggcgcgaagcgc
gtgctgcccgcctcgctcgtggtgacctactgggacggcaagggctacgtgccggtctcc
cacccctccatctcctgggcgtccgcctcgaaccagcccacggtgatctccttcgacccg
gtccagaccaccgagctgcggctggagatgacgagccccgctccggggtccgccaccggc
ttcctgcagatctcggagctcgaggtgccagtgagccgctga

DBGET integrated database retrieval system