KEGG   Cystobacter fuscus: CYFUS_001925Help
Entry
CYFUS_001925      CDS       T05065                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00500  Starch and sucrose metabolism
cfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYFUS_001925
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CYFUS_001925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase PelD_GGDEF
Motif
Other DBs
NCBI-ProteinID: ATB36510
UniProt: A0A250IZ15
LinkDB All DBs
Position
2335062..2336324
Genome map
AA seq 420 aa AA seqDB search
MLKKKVFGGAVSLSWALALLGAPAVFAGPMDGNSGDVMLQGFHWTSYQTSPWWGIVQGKA
SDIGASGFTMVWLPPSSDAASNEGYLPRQLSVLNSRYGTEAQLKSAIGALHTYNVKAIAD
IVINHRVGTTNWADFTNPTWGSWAVARGDEWTSATGNADTGDGYGAARDLDHTNATVQGD
LKSWMNWLKSSIGYDGWRYDYVKGFNGSYVGNYNTATVPYFSVGELWTDLNLANPDAHRQ
QLMNWLDATGGKSTVFDFTTKGILQQAVQYNEFWRLRDSAGKPSGAIGWWAAKSVTFIDN
HDTGPSTSGTSQNHWPFPSDKVMQGYAYILTHPGVPCVYWVHFYDWGHKDAIKTLMSIRK
AKGIHSTSAVSIQVADSSRYAAIITGTKGSVAMKIGPGDWSPGAGWTLGTSGTNYAVWTK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaagaaagtgtttggcggagccgtgtccctgtcgtgggccctggcgttgctg
ggtgcgccggccgtgttcgcggggcccatggatggcaacagcggcgatgtgatgctgcag
ggcttccactggacctcgtaccagacgtctccctggtggggcatcgtccagggcaaggcc
tcggacattggcgccagcggcttcaccatggtgtggctgccgccctccagcgacgcggcc
tccaacgaaggctacctgccgcgccagctcagcgtgctcaacagccgctacggcaccgag
gcgcagctcaagtcggccatcggcgcgctgcacacctacaacgtgaaggccatcgcggac
atcgtcatcaaccaccgcgtgggcaccaccaactgggcggacttcaccaaccccacctgg
ggctcgtgggcggtggcgcgcggggacgagtggacgagcgccacgggcaacgcggacacc
ggggatggctatggggcggcgcgcgacctggaccacaccaacgccacggtgcagggcgac
ctcaagagctggatgaactggctcaagtccagcatcggctacgacgggtggcgctatgac
tacgtgaagggcttcaacggctcgtacgtgggcaactacaacaccgccacggtgccctac
ttctccgtgggcgagctgtggacggacctgaacctcgccaaccccgatgcccaccggcag
cagctgatgaactggctcgacgccacgggcggcaagtcgacggtgttcgacttcaccacc
aagggcatcctccagcaggccgtgcagtacaacgagttctggcggctgcgtgacagcgcg
ggcaagccctcgggcgccatcgggtggtgggcggccaagtcggtgaccttcatcgacaac
cacgacacggggccgagcacctcgggcacgagccagaaccactggcccttccccagcgac
aaggtcatgcagggctacgcctacatcctcacgcacccgggcgtcccgtgcgtctactgg
gtgcacttctacgactggggccacaaggatgccatcaagacgctgatgtccatccgcaag
gccaagggcatccactccacgtcggcggtgagcatccaggtggcggactcgagccggtat
gccgccatcatcaccggcacgaagggcagcgtggcgatgaagatcggcccgggcgactgg
tcgccgggcgcgggctggacgctgggcacctcggggaccaactacgcggtgtggacgaag
tag

DBGET integrated database retrieval system