KEGG   Cystobacter fuscus: CYFUS_001959Help
Entry
CYFUS_001959      CDS       T05065                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cfus  Cystobacter fuscus
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CYFUS_001959
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfus03400]
    CYFUS_001959
Enzymes [BR:cfus01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CYFUS_001959
DNA repair and recombination proteins [BR:cfus03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CYFUS_001959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ATB36544
UniProt: A0A250IXT1
LinkDB All DBs
Position
2380011..2382608
Genome map
AA seq 865 aa AA seqDB search
MGTYGEKRDFSLTSEPGPDVEASPSGAAPLFVVHKHDATRLHYDLRLEIDGVLVSWAIPK
GPSYDPAEKRLAVQTEDHPLAYATFEGRIPDGAYGAGDSLLWESGTFDTVPPGQASEQLA
KGRLHVVLHGAKLMGEWHLIRTRPMGKKAQWLCFKAKDGTERPGYDVTEAHPESVKSGQR
VTRGPVRRTQRISEARPVRVSRPTRAKKAPALSPEALLEKVGAPMLATLAQVESTDQGEW
LYEVKYDGFRALAAFREGEVALHSRGGKDLSARFPDIARALGALGGHEAVVDGEIVALDD
RGRSRFQLLGKGVEERYVIFDVPWLDGEDLRPLPLEERRERLERLLARVKAPLQLAERVE
GSARQALALARRRGWEGVMAKRVGTPYSPGRGETWLKLKVQANQEVAIVGFTPMANERPE
LGSLLVGVREGKAWRYAGKVGTGYTTKVRRELRELLSRDEVKKPPVQEAPRVRDALHHEE
AIWVKPRHVAQVAFTEWTEDGRLRHPSFQGLRSDKRPEECVRERPIERPARRGPHRQTGR
KSRPGARSAGRSAISRKEAAAAKKEAAAAKKEAAAAKKGASAALVGLTHGDRVLFPEPGY
TKADVYRYFQDVAPFMVPALAGRPLTLQQWPQGVKAPGFFRQGVEHVPEGLSTVRITHET
RELSHVVVDRPESLLWLANQSALTLHMWSSRVPHLEQPDWVVFDLDPGPGGTFGDLIELA
TGLRRYLERLELVSVPKTSGKRGLHVLVPLSPGHTYEQARAFAHETFAALSEEYPELATI
ERSKSRRQGRLYLDADQNAWGKTVVAPYSPRALPHAPVSTPLAWSEVTRRLEPSRFTLGT
LRKRLDKVGDLFSPALKGRQSLPNR
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
ttgggaacctatggcgagaagcgtgacttctccctcacctcggagcccggccccgatgtc
gaggcctcgccctcgggggcagcccctctcttcgtggtgcacaagcacgacgccacgcgg
ctgcactatgacctgcggctggagatcgacggggtgctggtgagctgggccattcccaag
ggccccagctacgatccggccgagaagcggctcgcggtgcagaccgaggaccaccccctg
gcctatgccaccttcgagggccgcatccccgatggggcctatggggcgggagactcgctg
ctgtgggagtcgggcaccttcgacacggtgcctcccgggcaggcctccgagcagctcgcg
aaggggcggctgcacgtggtgctgcacggcgcgaagctgatgggcgagtggcacctcatc
cgcacgcgtcccatgggcaagaaggcgcagtggttgtgcttcaaggccaaggatggcacc
gagcgccccggttatgacgtcaccgaggcccaccccgaatccgtgaagtccggccagcgc
gtcacccgcggccccgtgcggcgcacccagcgcatctccgaggccagacccgtgcgcgtc
tcccgccccacccgcgcgaagaaggctccggccctctctcccgaggcgctgctggagaag
gtgggcgcgcccatgctcgccacgctcgcccaggtggagtccaccgatcagggcgagtgg
ctctacgaggtgaagtacgacgggttccgcgcgctcgccgcgtttcgcgagggcgaggtc
gcgctgcactcgcgcggcggcaaggatctgtcggcgcgcttccccgacatcgcccgggcg
ctcggggcgctcggtgggcacgaggcggtggtggacggggagatcgtcgccctggacgac
agggggcgctcccgcttccagctcctcggcaagggggtcgaggaacgctacgtcatcttc
gatgtgccgtggctcgatggggaggacttgcggccgctgcccctggaggagcgtcgcgag
cggctcgagcggctgctggcgcgcgtgaaggcgcccctgcaactcgccgagcgggtggag
ggcagcgcgcggcaggcgctggccctggcgcggcggcgcggctgggaaggcgtcatggcc
aagcgcgtgggcaccccctattcaccgggccgcggcgagacctggctcaagctcaaggtc
caggccaaccaggaggtggccatcgtgggcttcacgcccatggccaacgagcggcccgag
ctgggctcgctcctggtgggagtgcgagaggggaaggcctggcgctacgcgggcaaggtg
gggaccgggtacacgacgaaggtgcggcgggagttgcgcgagctgctgtcacgcgacgag
gtgaagaagccccccgtccaggaggctccgcgtgttcgtgacgcgctgcaccacgaggag
gccatctgggtgaagccccgccatgtggcgcaggtggcgttcaccgaatggaccgaggat
gggcggctgcgccatccctccttccagggactgcggagcgacaagcgccccgaggagtgt
gtccgggagcggcccatcgagcggcccgcccgccggggtccccaccgtcagacggggcgc
aagtcccgcccgggggcgcgctccgcgggcagatccgccatctcccggaaggaggccgcc
gcggcgaagaaggaggccgccgcggcgaagaaggaggcggctgcggcgaagaagggggcg
agcgcggccctggtggggctcacccacggggatcgggtgctcttccccgagccgggctac
accaaggcggacgtgtaccgctacttccaggacgtcgcgcccttcatggtcccggcgctg
gcgggccggcccctcacgctgcagcagtggccccagggggtgaaggcgccgggcttcttc
cgccagggcgtggagcacgtgccggaggggctctccacggtgcgcatcacccacgagacg
cgcgagctgtcccacgtggtggtggatcggcccgagtccctcctgtggctcgccaaccag
tccgcgctcaccctgcacatgtggtccagccgggtgccgcacctggagcagcccgactgg
gtggtgttcgacctggatccgggccccggggggaccttcggggatttgatcgaactggcc
accgggttgcggcgctacctggagcggctggagctggtcagcgtgccgaagacttccggc
aagcggggcctgcacgtgctggtgcccctgtctccgggccacacctacgagcaggcgcgc
gcgttcgcccacgagaccttcgcggcgctctcggaggagtacccggagctggcgaccatc
gagcgctccaagtcgcggcgccaggggcggctgtacctggacgcggaccagaacgcctgg
ggcaagacggtggtggcgccctactctccgcgtgcgttgccgcacgcacccgtgtccaca
cccctcgcgtggtcggaggtgacgcgccggttggagccctcgcgcttcacgctgggcacc
ctgcgcaagcgcctggataaggtgggagatctgttctccccggccttgaaggggcgtcaa
tctctgcccaatcgctga

DBGET integrated database retrieval system