KEGG   Cystobacter fuscus: CYFUS_003013Help
Entry
CYFUS_003013      CDS       T05065                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00010  Glycolysis / Gluconeogenesis
cfus00020  Citrate cycle (TCA cycle)
cfus00620  Pyruvate metabolism
cfus01100  Metabolic pathways
cfus01110  Biosynthesis of secondary metabolites
cfus01120  Microbial metabolism in diverse environments
cfus01130  Biosynthesis of antibiotics
cfus01200  Carbon metabolism
Module
cfus_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYFUS_003013
   00020 Citrate cycle (TCA cycle)
    CYFUS_003013
   00620 Pyruvate metabolism
    CYFUS_003013
Enzymes [BR:cfus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CYFUS_003013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_2
Motif
Other DBs
NCBI-ProteinID: ATB37591
UniProt: A0A250J2J4
LinkDB All DBs
Position
3695863..3697461
Genome map
AA seq 532 aa AA seqDB search
MATPIQMPSLSPTMKEGKIVKWLKKEGDKVSSGEAIAECETDKSNLEIEAYDDGYLLKIL
VPEGEMATVGAPIAMLGAKGEKADAGGGAKPAAPAAAPKAEAPKPAAQPEAKKPEAAPAA
ASGGDGIAIAMPSMSPTMTEGKIVKWLKKEGDKISSGQAIAEVETDKSNLEVEAYDDGVL
ARIVVREGEVAKVGAPIAYLAGKGGAKPAPAATPAAPSAKAPAATPPAAAPAPKPSAPAA
ASGGRLRASPLAKKMAQEKGLDLSQIQGSGPAGRIVKRDIEAASTQAAAPAARKAPAAAA
AQATGPRPEPKSVPVSTMRKVISQRMAEVKPGVPHFYLSVDVEMDAALKIREEAKALESK
VSVNDIIVKASAMALRRYPKMNVSLQGDAILHFESVDVGIAVAIEEGLITPIIRDADKKG
LSAISAEARDLAERARKRALKPAEYTGGSLTVSNLGMYGIDSFIAVINPPQAAILAVGSV
SDKVVVREGQMVIRKVMTVTLSGDHRVIDGAIGAEYLRELKALLEHPMRLLF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcccatccagatgccttccctctctccgacgatgaaggagggaaagatcgtc
aagtggctcaagaaggagggcgacaaggtctcctctggcgaagcgatcgccgagtgcgag
accgacaagtcgaacctcgagattgaggcctacgacgatggttacctgttgaagatcctc
gtgcccgagggggagatggccaccgtgggtgcgcccatcgccatgctcggcgccaagggg
gagaaggccgacgcgggtgggggcgccaagcccgccgctcccgccgccgcgcccaaggcg
gaggctcccaagcccgccgcccagcccgaggcgaagaagcccgaggccgctccggccgcc
gcctccggtggcgacggcatcgccatcgccatgccctcgatgtccccgacgatgaccgag
gggaagatcgtcaagtggctcaagaaggagggggacaagatctcctccggccaggcgatc
gccgaggtggagacggacaagtccaacctcgaggtcgaggcgtacgacgacggcgtgctc
gcgcgcatcgtggtgcgcgagggcgaggtggccaaggtgggtgcgcccatcgcgtacctg
gcgggcaagggtggggcgaagcccgctccggccgcgacgccggcggctccttccgccaag
gctcccgccgccacgccccccgcggcggctccggcgcccaagccgagcgctcccgccgcc
gcttccgggggccggctgcgcgccagcccgctggcgaagaagatggctcaggagaagggc
ctggatctgtcgcagatccagggctcgggtcccgcgggccgcatcgtgaagcgggacatc
gaggcggcgtccacccaggccgccgctcccgccgcgcgcaaggctcccgccgccgccgcg
gcccaggccacgggaccccgtcccgagccgaagtcggtgcccgtctccaccatgcgcaag
gtcatcagccagcgcatggccgaggtgaagcccggggtgccccacttctacctgtcggtg
gacgtggagatggacgccgcgctgaagatccgcgaggaggccaaggccctggagtccaag
gtctcggtcaacgacatcatcgtgaaggcgtcggccatggcgctgcgccgctacccgaag
atgaacgtgtcgctgcagggcgacgcgatcctgcacttcgagtcggtggatgtcggcatc
gcggtggccatcgaggagggcctcatcaccccgatcatccgcgacgcggacaagaagggg
ctgagcgccatctccgccgaggcgcgtgacctggccgagcgcgcccgtaagcgcgccctc
aagccggcggagtacacgggcggctcgctcacggtgagcaacctgggcatgtacggcatc
gactcgttcatcgccgtcatcaacccgccccaggcggccatcctcgcggtgggctccgtg
tcggacaaggtcgtcgtgcgcgaggggcagatggtgatccgcaaggtgatgacggtgacg
ctctcgggcgaccaccgcgtcatcgacggggccatcggcgccgagtacctgcgggaactc
aaggcgctgctcgagcacccgatgcggctgctgttctag

DBGET integrated database retrieval system