KEGG   Cystobacter fuscus: CYFUS_003171Help
Entry
CYFUS_003171      CDS       T05065                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYFUS_003171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfus02000]
    CYFUS_003171
Enzymes [BR:cfus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CYFUS_003171
Transporters [BR:cfus02000]
 Other Transporters
  Pores ion channels [TC:1]
   CYFUS_003171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_2 GST_C_2 GST_N_3 GST_C_6 Tom37 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: ATB37746
UniProt: A0A250J3L1
LinkDB All DBs
Position
complement(3895399..3896007)
Genome map
AA seq 202 aa AA seqDB search
MKLYYTPGACSLSPHIVLREAGQTFDIEKVDLRTKKTESGKDFTSVNPNGYVPALQLDDG
STLTEGPAIVQYIADKAPQSKLAPANGTLERYKLQEALNFIGTELHKSFGPLFNPAFPED
ARTLVKGNIDKRLTAVNERLSKQSHFLGEQFTVADAYLFTVLSWTGHLGIDLSKFPAIQA
YQGRVAARPNVQAALKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacacgcctggtgcttgttcgctgtcgccccacatcgtcctgcgcgag
gcgggccagaccttcgacatcgagaaggtcgatctgcgcaccaagaagaccgagagcggc
aaggacttcacctccgtcaaccccaacggctacgtgcccgccctgcagctggacgacggc
agcaccctcaccgagggcccggccatcgtgcagtacatcgccgacaaggcgccccagtcc
aagctcgcgccggccaacggcaccctggagcgctacaagctgcaggaggcgctcaacttc
atcggcaccgagctgcacaagagcttcggcccgctcttcaaccccgccttccccgaggac
gcccggacgctggtgaagggcaacatcgacaagcgcctgaccgcggtgaacgagcggctg
tccaagcagtcccacttcctcggcgagcagttcaccgtcgccgacgcctacctcttcacc
gtgctgagctggaccgggcacctgggcatcgatctgagcaagttcccggcgatccaggcc
taccagggacgcgtggccgcgcgccccaacgtgcaggccgccctgaaggccgaaggcctg
ctgaagtaa

DBGET integrated database retrieval system