KEGG   Cystobacter fuscus: CYFUS_004342Help
Entry
CYFUS_004342      CDS       T05065                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00500  Starch and sucrose metabolism
cfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYFUS_004342
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CYFUS_004342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ATB38905
UniProt: A0A250J4P2
LinkDB All DBs
Position
complement(5384889..5387045)
Genome map
AA seq 718 aa AA seqDB search
MSSRGWRSRRRWAPLAGGVLLASCATPRVPAGRPGAAAVWTPANKVGFGTARAETSRVWH
TLGARGELTEVYFPTLGTPSVRELYFVVSDGRTFAEREQDATEHDVELVDPRSLTYRQVN
TDRSGRYRITKTYVTEPERDALLLDVRFESFTGTPYALYAVYDPSLSNDGMDDTGRSEGG
ELLASDAKNASALVGQPGFTRTTSGYLGASDGWTDLQKDFTLDGEFAEAPSGNVVQTARV
AVDGRETQQATLVLGFGATEAEARRAARDSLERGFEDVARRYAEGWHAYLDALPAAPPST
QVWRATYDVSVMVLAASEDKTYRGAFIASPSMPWAWGTGEIDKPSAAYHLVWSRDLYQIA
TGLLAAGDRAGAGRALDHLFQVQQKPDGSFPQNADVDGTPRWGSLQLDEVALPLVLAWQL
GRDDARTYTEHVRKAADFLLAHGPSTPQERWENQSGYSPATLAAEVAGLVCAADLARRNG
DTASAERYESTADAWQRQVEGWTVTHTGPLAPHPYYLRLTKDGAPDHATTYSIGDGGPSA
VDQRQVVDPSFLELVRLGVKPAEDPLIAQTLAVVDAQLKVDGPQGAVWRRFSADGYGETR
EGAPWGLSKPDTGRTIGRGWPLLAGERGEYALLVGQPAGDYLATMARSGNEGLMLPEQVW
DLRPPTGQPGYLAGEATFSATPLTWTHAQFVRLAWSIQEGRPVEQPSVVACRYTSVCR
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccagaggatggcggtccaggaggcggtgggcgccgctcgcgggaggcgtgctg
ctggcctcgtgcgccacgccgcgcgtgccggcgggacggcccggagcggccgcggtgtgg
acccccgccaacaaggtgggctttggtacggcgcgcgcggagacgagccgggtctggcac
acgctcggcgcccgcggggagctgacggaggtgtacttcccgacgctcgggacgcccagc
gtgcgggagttgtacttcgtcgtctccgatggccgcaccttcgccgagcgggagcaggac
gccaccgagcacgacgtggagctggtggatccccgcagcctcacctaccgccaggtgaac
acggatcgctccgggcgctaccgcatcaccaagacgtacgtgacggagccggagcgggac
gcgctgctgctcgacgtgcgcttcgaatccttcaccggaacaccctacgccctgtatgcg
gtgtacgacccgtcgttgtccaacgacggcatggacgacacgggccggagcgagggcggg
gagctgctcgcctccgatgcgaagaacgccagcgcgctggtggggcagcccggcttcacc
cggacgacgagcggctacctcggcgcgagcgatggctggacggacctccagaaggacttc
acgctcgatggggagttcgccgaggcgccctcgggcaacgtggtgcagacggcgcgggtg
gcggtggatgggcgcgagacgcaacaggcgaccctggtgctcggcttcggggccaccgag
gccgaggcacggcgggcggcgcgggactcgctcgagcggggcttcgaggacgtggcgcgg
cggtacgcggagggctggcacgcctatctggacgcactgcccgcggcgcccccgagcacc
caggtgtggcgggcaacctatgacgtgtcggtgatggtgctggcggcctcggaggacaag
acgtaccggggcgccttcatcgcgtctccgagcatgccctgggcgtggggcacgggggag
atcgacaagccatcggccgcctaccacctcgtgtggtcacgcgatctgtaccagatcgcc
accgggctgctggcggcgggggaccgggccggggccgggcgcgccctggatcacctcttc
caggtccagcagaagccggacggctccttccctcagaacgcggacgtggacgggacaccg
cgctggggcagcctgcaattggacgaggtggccctgccgctcgtgctggcatggcagctc
ggccgcgacgatgcgcgcacgtacaccgagcatgtgcgcaaggcggcggacttcctgctc
gcccacggcccgtcgacgccccaggagcgttgggagaaccagtcgggttactctcccgcg
accctggcggcggaggtggcggggctcgtctgcgccgcggacctcgcgcgccgcaatggg
gacaccgcgtcggccgagcggtacgaatcgaccgcggacgcgtggcagcgccaggtggag
ggctggacggtgacccacaccggccctctggctccacatccgtactacctgcggctcacc
aaggacggcgcgcccgaccacgcgacgacgtactccatcggggatggagggccttccgcc
gtggatcagcgccaggtggtggacccgagcttcctcgagctggtgcgactgggggtcaag
cccgcggaggatccgctcatcgcgcagacgctggcggtggtggacgcccagctcaaggtg
gacggtccccagggggcggtctggcgccggttcagcgccgacggatacggggagacgcgc
gagggcgcgccgtgggggttgagcaagcccgacaccgggaggacaatcggacgggggtgg
ccactgctcgccggggagcggggcgagtacgcactcctggtgggacagcccgccggggac
tacctcgccacgatggcccgctcgggcaacgaggggctgatgctccccgagcaggtgtgg
gatctgcggccccccacgggacagcctggctacctcgcgggcgaggcgacgttctcggcc
acgcctctcacctggacacatgcccagttcgtgcgtctggcctggtccatccaggagggg
cgtccggtggaacagccctcggtggtggcttgccgctacacgtccgtttgtcgatag

DBGET integrated database retrieval system