KEGG   Cystobacter fuscus: CYFUS_004661Help
Entry
CYFUS_004661      CDS       T05065                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cfus  Cystobacter fuscus
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfus01002]
    CYFUS_004661
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfus04147]
    CYFUS_004661
   04090 CD molecules [BR:cfus04090]
    CYFUS_004661
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CYFUS_004661
Peptidases [BR:cfus01002]
 Metallo Peptidases
  Family M2
   CYFUS_004661
Exosome [BR:cfus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYFUS_004661
CD molecules [BR:cfus04090]
 Proteins
  CYFUS_004661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Alanine_zipper
Motif
Other DBs
NCBI-ProteinID: ATB39220
UniProt: A0A250J6R3
LinkDB All DBs
Position
5798640..5800562
Genome map
AA seq 640 aa AA seqDB search
MTHTPLRSFFLRAALLAVPLAASAGCTSSAHGATAAPSEAAPGATPATVPPQSATTQADG
AALTAEDARQFATRVNDELKRLWVKQATADWIKSTYITDDTERNAASVNEEVMAYLSQAI
PQAARFKDVKGLDAESARVLRLLRLSSMLPAPNEPAQRSELASIAAKLEGIYGKGKYCGK
DGKGACKDLGELSDVMATNRDYNTLLEAWVGWHTISQPMRPLYERLVSLSNAGAQEIGFK
DLGALWRSNYDMPPEAFEQEAQRLWGQVKPLYDDLHCYVRARLAKQYGEDKVPAGKAIPA
HLLGNMWAQEWNNIYGLVEPYKGQPSLDVDAELKKQKYDAIRMVKLGEGFFTSLGLKPLP
ETFWQRSQFTKPRDREVVCHASAWDVTYDNDLRIKMCIKTTEEDLVTIHHELGHDYYYTY
YYKLPVLFQQGANDGFHEAIGDAITLSITPGYLKQMGLLKDVPTGDKGLINLQMKDAMEK
VAFLPFGLLVDQWRWEVFSGRVTPADYNASWWALREKYQGVRAPVERSEKDFDAGAKYHV
PANVPYTRYFLARILQFQFHRALCQAAGHQGPLHECSIYGNKEAGKRLQAMLELGASKPW
PEALVALTGQREMDASAMLEYFTPLRRWLQEQNKGQQCGW
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgactcacaccccgctccgttccttcttcctgcgcgcggccctcctggccgtgccgctc
gccgcctccgctggctgcacgtcctcggcccatggcgccacggccgcgccctccgaggcc
gctcccggcgcgacccccgcgacggttcccccccagtccgccaccacgcaggccgacggg
gcggccctcaccgcggaggacgcgcgccagttcgccacccgcgtgaatgacgagctcaag
cgcttgtgggtgaagcaggccacggccgattggatcaaatccacctacatcaccgacgac
acggagcgcaacgcggcgagcgtcaacgaggaggtgatggcctacctcagccaggccatc
ccgcaggccgcgcgcttcaaggacgtgaaggggctggatgcggagtccgcgcgcgtgctg
cggctgctgcggctgtcctccatgctgcccgcgcccaacgagccggcgcagcgctcggag
ctggcgtccatcgccgcgaagctcgagggcatctacggcaagggcaagtattgcggcaag
gatggcaagggggcctgcaaggacctgggcgagctgtccgacgtcatggccaccaaccgc
gactacaacacgctgctggaggcgtgggtggggtggcacaccatctcccagcccatgcgt
ccgctctacgagcgcctggtgtcgctgtccaacgcgggtgcccaggagatcggcttcaag
gacctgggggcgctgtggcgctcgaactacgacatgccgcccgaggccttcgagcaggag
gcccagcggctgtgggggcaggtcaagccgctctatgacgacctgcactgctacgtgcgc
gcccgtctcgccaagcagtacggcgaggacaaggtgcccgcgggcaaggccattcccgcg
cacctgttgggcaacatgtgggcgcaggagtggaacaacatctatggcctcgtggagccc
tacaagggccagcccagcctggacgtggacgcggagctgaagaagcagaagtacgacgcc
atccgcatggtgaagctgggcgaggggttcttcacctcgctgggcctcaagcccctgccg
gagacgttctggcagcgctcgcagttcaccaagccgcgcgatcgcgaggtggtgtgccat
gccagcgcgtgggacgtcacctacgacaacgacttgcgcatcaagatgtgcatcaagacc
accgaggaggacctggtcaccatccaccacgagctggggcacgactactactacacgtat
tactacaagctgccggtgctctttcagcagggcgccaatgatggctttcacgaggccatc
ggtgatgccatcaccctgtccatcaccccgggctatctcaaacagatgggcctgttgaag
gacgtgcccacgggggacaagggcctcatcaacctgcagatgaaggacgcgatggagaag
gtggccttcctgcccttcggtctgctggtggatcaatggcgttgggaggtgttctccggg
cgggtgacgccggcggactacaacgcgtcctggtgggcgctgcgcgagaagtaccagggc
gtgcgcgcgccggtggagcgctcggagaaggacttcgacgcgggcgccaagtaccacgtc
cccgccaacgtgccctacacgcgctacttcctggcgcgcatcctccaattccagttccac
cgcgccctctgccaggccgccggccaccagggcccgctgcacgagtgctccatctatggc
aacaaggaggctggcaaacggctccaggccatgctggagctgggcgcgagcaagccctgg
cccgaggcgctcgtggcgctcaccggccagcgggagatggatgcttcggccatgctggaa
tacttcactcccctgcgtcgctggttgcaggaacagaacaagggacagcagtgcggttgg
taa

DBGET integrated database retrieval system