KEGG   Cystobacter fuscus: CYFUS_005556Help
Entry
CYFUS_005556      CDS       T05065                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYFUS_005556
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfus01002]
    CYFUS_005556
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
    CYFUS_005556
Enzymes [BR:cfus01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CYFUS_005556
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CYFUS_005556
Peptidases [BR:cfus01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CYFUS_005556
Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CYFUS_005556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ATB40108
UniProt: A0A250J975
LinkDB All DBs
Position
complement(6910942..6912513)
Genome map
AA seq 523 aa AA seqDB search
MFRAEPFVRSLLDGRRAGTYGASMRRPPFASLLLAVLALPACISSPPLRPPAPTLSAVAD
ALFESVEREGTGVGVLVVDAATGTPLYARREHARSLPASTMKVVSTSAALSAFGPDFRFH
TPVWLEGAQLGNLFLGDLVVEASGDPSLGSWRFPETALACERLADALLARGIRQWHGSVQ
VSQTNPGPYDLYGPGWAWDDAASAYSAAPTAFVFRENVVDLTLTRPEGQDCASPLRRPLE
VRYTPPIDASSTVVYTDPGAQRAGVGCVRERGTGRTRCVWRAPGGQCPSQASLRVSVDEP
QALFTACLEEALRARGIWRVPEASGQATPPALLRRESLLDFVSPSLAELVKVTNKESLNL
YAERLALRFARERTGNESYAALREAMEKELARRGIPPRLLRSVDGSGLSRYNLATARGMV
GVLATSLQEPSASALVDSLPIAGVDGTLANSAFPPELRGLIRAKTGTLSGQKAYVGLAER
PHDAEHPRVVFALLLSNLDEQPAYTAGQVFERFAEAMVMLPSR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgcggagcccttcgtgcgttcgctcctggacggccggagggccgggacgtac
ggtgcttccatgcgccgtcccccgttcgcgagcctcctgctcgccgtcctcgcgctaccc
gcctgtatctcctcgcccccgctccgtcctcccgccccgaccctgagcgccgtggcggac
gcgctcttcgagtccgtcgagcgcgagggcaccggcgtgggcgtcctcgtggtggacgcg
gccacgggcacgccgctctacgcccggcgcgagcacgcccgctcgctccccgcgtccacc
atgaaggtggtgtccacctcggccgccctgtccgcgttcggtccggacttccgcttccac
acgcccgtgtggttggaaggcgcgcagcttggcaacctcttcctcggagatctcgtggtg
gaggcgtccggagatccctccctgggctcgtggcgctttcccgagacggccctggcctgt
gagcggctcgccgacgcgctgctggcccggggcatccggcagtggcacgggtcggtccag
gtgagccagaccaacccggggccgtacgatctctatggtccgggctgggcctgggacgac
gcggcctccgcctacagcgcggcgcccaccgccttcgtgttccgggagaacgtggtggac
ctcacgctcacgcgccccgagggccaggactgtgcctcgcccctgcggcggcccctggag
gtgcgctacaccccgcccatcgatgcgtcctcgaccgtggtgtacaccgacccgggcgcc
cagcgggccggggtggggtgcgtgcgcgagcgagggacgggacgcacgcgctgcgtctgg
cgcgcgccgggaggacagtgcccgagccaggcgtccctacgcgtgtccgtggacgagccc
caggcgctgttcaccgcctgtctggaagaggccctgcgcgcgcggggcatctggcgcgtg
ccggaggcgtcggggcaggccaccccgcccgcgctcctgcgacgcgagtcgttgctggac
ttcgtcagtccctcgctcgccgagctcgtgaaggtgacgaacaaggaatccctcaacctc
tacgccgagcggctcgccttgcgcttcgcccgcgagcgcacgggcaacgagagctacgcc
gcgctgcgcgaggccatggagaaggagctcgcgcgccggggcatcccgccgcgactgttg
cggtccgtggatggcagtggcttgtcccgctacaacctggccaccgcgcgggggatggtg
ggggtgctcgccaccagcctccaggagccgtccgcgagcgcgctggtggacagcctgccc
attgccggcgtggatggcacgctcgcgaacagtgccttcccgccggagctccggggcctc
atccgcgccaagacggggacgctctcggggcagaaggcctacgtggggctcgccgagcgc
cctcacgacgccgagcacccccgtgtcgtcttcgcgctcctgctgagcaacctcgacgag
cagccggcctacacggcgggccaggtgttcgagcgcttcgccgaggcgatggtgatgctg
ccttcgcgctga

DBGET integrated database retrieval system