KEGG   Cystobacter fuscus: CYFUS_005924Help
Entry
CYFUS_005924      CDS       T05065                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00620  Pyruvate metabolism
cfus00680  Methane metabolism
cfus01100  Metabolic pathways
cfus01120  Microbial metabolism in diverse environments
cfus01200  Carbon metabolism
Module
cfus_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYFUS_005924
  09102 Energy metabolism
   00680 Methane metabolism
    CYFUS_005924
Enzymes [BR:cfus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CYFUS_005924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATB40475
UniProt: A0A250J993
LinkDB All DBs
Position
complement(7401855..7404524)
Genome map
AA seq 889 aa AA seqDB search
MPPIRHVDLPLRQDVRLLGQLLGEVIIEQEGQAVFELEERVRRLSIERRRGPKSGRRAAA
SELAALLRRMPLSQAEPVLRAFSTYFRLVNLAEQNHRIRRTREHEVAGSRGPQRGSLEAV
MHSLRQAGVGAARLREVLQSMRVTLTLTAHPTQAARRTVLEKTYRLARLLENRDRSQLTP
REKADTHAAMREEISALWQTDELRRERPTVGDEVKNVLWYVEEVLAEQLALMPETLDWAF
ERAYGEPLGVLATPVRLHSWVGGDMDGNPLVTPEVFADTLRAHRARGLRALRTQIARLGW
VLTQSERHTHVSEELRSSLAQDARVLPEVMTRYGARTEGEPWRRKLRFIEGRLQAALVYV
EGRRAGRADPLPDAAYRSPADLLADLHLLERSLQAARGGHAGVRKIQRLIALVRAVGFHL
AELEVRAPAEDARSAAASLKGGPAPTEGGKRLLAVLQRMREAQSESGEGCCRTLILSMAS
TAEDVLAAFECARASGLWDEARGCATVDVVPLFEQLGALDDGPRVLRELFTHAEYRRHLS
ARGVQEVMVGYSDSGKEVGLLAASAALYRAQSALTQVAREAGIRLRLFHGRGETVARGGG
PAQQAILALPRGSVGGTYKATEQGEALDHKYARPELARRTLELVLGGVLLHSLDAQPRLA
PEEEPAFRAAFDELAEMGRRAYRALVWEDERFVPFFQAATPIEEIAALPIGSRPSKRAAG
GLESLRAIPWVFSWTQNRAILPGWYGVGSALEELGSRPEGLTLLTRMYRQWPYFHAVIDN
VAMVLAKSDIAIASRYAALAPESTRPLWERIRAEYSRTRRWVKRVTGEKRLLANNRQLQQ
SIALRNPYIDPMSFLQVELMRRKRAGEDHCDRPLLLTLAGIAVGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccattcgtcatgtcgatctgccgttgcgccaggacgtccggctgctgggccag
ctgctcggggaagtgatcatcgagcaggagggccaggccgtcttcgagctggaggagcgc
gtgcgtcgcctctccatcgagcggcggcggggccccaagtccggacgccgggccgccgcc
tcggagctggcggcgttgctgcgccgcatgcccctgagccaggccgagcccgtgctgcgc
gccttctccacgtacttccgcctcgtcaacctcgccgagcagaaccaccgcatccgccgc
acccgcgagcacgaggtcgccggctcccggggcccccagcggggctcgctcgaggcggtg
atgcactccctgcggcaagcgggcgtgggcgccgcgcggctgcgcgaggtgctccagtcc
atgcgcgtcaccctcaccctcaccgcgcaccccacccaggccgctcgccgcacggtgctg
gagaagacgtaccgcctggcccggctcctcgagaaccgcgaccgcagccagctcaccccg
cgcgagaaggccgacacccacgcggccatgcgcgaggagatctccgccctctggcagacg
gacgagctgcggcgcgagcgccccaccgtgggcgacgaggtgaagaacgtcctctggtac
gtggaggaggtgctcgccgagcagctcgcgctcatgcccgagacgctcgattgggccttc
gagcgcgcctatggcgagccgctgggggtactcgccacccccgtgcgtctgcactcgtgg
gtgggcggggacatggatggcaacccgctggtgactcccgaggtgttcgcggacaccctg
cgcgcccaccgcgcccgcggactgcgcgccctgcgcacgcagatcgcccggttgggctgg
gtgctcacccagtccgagcgccatacccatgtctccgaggagctccggagctcgctcgcg
caggacgcccgtgtcctgcccgaggtgatgacccgctacggcgcgcgcaccgagggcgag
ccctggcgccgcaagctgcgcttcatcgagggccggctccaggccgccctggtctacgtc
gagggccgccgagcgggccgcgccgatccgcttcccgatgccgcctaccgctcgcccgcg
gatctcctcgcggacctgcacctgctcgagcgctcgttgcaggcggccagggggggacac
gcgggcgtgcggaagattcaacgcctcatcgccctggtgcgcgccgtgggcttccacctg
gccgagctggaggtgcgcgcccccgccgaggacgcgcgtagcgccgccgcgtccctcaag
ggaggccccgcgccgacggagggcggcaagcgcctcctggccgtgctccagcgcatgcgc
gaggcccagtccgagtcgggcgagggctgctgccgcacgctcatcctctccatggcctcc
actgccgaggacgtgctggcggcgttcgagtgcgcgcgggcctcggggttgtgggacgag
gcgcgcgggtgcgccaccgtggacgtggtgcccctcttcgagcagctcggcgcgctggat
gatgggccgcgcgtgctgcgcgagctgttcacccatgccgagtaccgccggcacctctcg
gcccggggtgtccaggaggtgatggtgggctacagcgactcgggcaaggaggtggggctg
ctcgccgcgagcgccgcgctctaccgcgcccagtccgcgctcacccaggtggcgcgtgag
gcgggcatccggctgcgcctcttccacggccgcggcgagacggtggcgcgcggcggtggt
cccgcccagcaggccatcctcgcgctgccccggggcagcgtcggcggcacctacaaggcc
accgagcagggcgaggcgttggatcacaagtacgcccggcccgagctggcccggcgcacc
ctggagctggtgctcggtggcgtgctgctgcactcgctcgacgcgcagccgcgcctggcc
ccagaggaggagcccgccttccgcgccgccttcgacgagctggcggagatgggccgccgc
gcctaccgcgcgctcgtctgggaggacgagcgcttcgtgcccttcttccaggcggccacc
cccatcgaggagatcgccgcgctgcccatcggctcgcgtccgagcaagcgcgccgccgga
ggcctcgagtcgctgcgcgccatcccctgggtgttctcctggacgcagaaccgcgccatc
ctccccggctggtacggcgtgggctcggcgctggaggagctgggctcgcggcccgagggc
ctcacgttgctcacgcgcatgtaccggcagtggccctacttccacgccgtcatcgacaac
gtggccatggtgctcgccaagtcggacatcgccatcgcctcgcgctacgcggcgctggcg
cccgagtccacgcggcccttgtgggagcgcattcgtgccgagtactcgcgcacccgccgc
tgggtgaagcgcgtgacgggcgagaagcgcctgctggccaacaaccgccagctccagcag
agcatcgccctgcgcaacccctacatcgatcccatgtccttcctccaggtggagctgatg
cggcgcaagcgcgcgggagaggaccactgcgatcggcccctgctgctcacgctcgccggc
atcgccgtgggcatgcgcaacacggggtga

DBGET integrated database retrieval system