KEGG   Cystobacter fuscus: CYFUS_006963Help
Entry
CYFUS_006963      CDS       T05065                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00071  Fatty acid degradation
cfus00280  Valine, leucine and isoleucine degradation
cfus00281  Geraniol degradation
cfus00362  Benzoate degradation
cfus00592  alpha-Linolenic acid metabolism
cfus01100  Metabolic pathways
cfus01110  Biosynthesis of secondary metabolites
cfus01120  Microbial metabolism in diverse environments
cfus01130  Biosynthesis of antibiotics
cfus01212  Fatty acid metabolism
Module
cfus_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CYFUS_006963
   00592 alpha-Linolenic acid metabolism
    CYFUS_006963
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CYFUS_006963
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CYFUS_006963
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CYFUS_006963
   00642 Ethylbenzene degradation
    CYFUS_006963
Enzymes [BR:cfus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CYFUS_006963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C HHH_5
Motif
Other DBs
NCBI-ProteinID: ATB41497
UniProt: A0A250JDA0
LinkDB All DBs
Position
complement(8740324..8741496)
Genome map
AA seq 390 aa AA seqDB search
MPGRVVIASAVRTPFTRAHKGEFKDTRPDTLAALAIKEAVARVPGLKPEQVEDVILGCAM
PEAEQGMNVARNASLLAGLPDTVPGMTINRFCSSGVQSIAQAAQAIQAGSIQVAVAGGTE
SMTMVPMGGNKVSANPEIMEKYPEVYTSMGATAENIASRYSVSREDADKFAYESQRKAAT
AREQGKFKDEIFPVTTTVYDEEGNAKQVTVSVDTILRPETTLEGLAKLRPAFNQKGVVTA
GNASPLTDGAAAAVVMSEEKAKELGVKPLGYFVDFQVAGVPPEIMGVGPVPAVKKLLAKN
NLKIEDIDVFELNEAFAAQALHCIRELGVPLEKANPNGGAIALGHPLGVSGARMVATILS
ELKRRDGRYGVVTMCIGGGMGAAALIERVK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcgagtcgtgattgccagcgcggtgcgtaccccgttcacccgcgcgcacaag
ggagagttcaaggatacccggcccgatacgctcgcggccctcgccatcaaggaggccgtg
gcgcgcgtgcccggcctcaagcccgagcaggtcgaggacgtcatcctcggctgtgccatg
cccgaggcggagcagggcatgaacgtggcgcgcaacgcctcgctgctggcggggctgccg
gacaccgtgccggggatgaccatcaaccgcttctgctcgtcgggcgtgcagtccatcgcc
caggcggcgcaggccatccaggcggggtccatccaggtcgccgtggccggtggcaccgag
tccatgaccatggtgcccatgggcggcaacaaggtgagcgccaacccggagatcatggag
aagtaccccgaggtctacacctccatgggcgccaccgcggagaacatcgcctcgcgctac
agcgtgtcgcgcgaggacgcggacaagttcgcctacgagagccagcgcaaggcggccacc
gcgcgcgagcagggcaagttcaaggacgagatcttccccgtcaccaccaccgtgtatgac
gaggagggcaacgccaaacaggtgacggtgtccgtggacaccatcctgcgcccggagacc
acgctggaggggctcgccaagctgcgccccgccttcaaccagaagggcgtggtgacggcc
ggtaacgcctcgccgctgacggatggcgccgccgccgcggtggtgatgagcgaggagaag
gcgaaggagctgggcgtcaagccgctgggctacttcgtggacttccaggtggcgggcgtg
cctccggagatcatgggcgtgggcccggtgccggcggtgaagaagctgctcgcgaagaac
aacctcaagatcgaggacatcgacgtcttcgagctcaacgaggccttcgctgcgcaggcg
ctgcactgcatccgcgagctgggcgtgcccctggagaaggccaacccgaacggcggcgcc
atcgccttgggccacccgctgggcgtgtctggtgcgcgcatggtggccaccatcctgagc
gagctcaagcgccgcgacggccgctacggcgtggtgacgatgtgcatcggtggcggcatg
ggcgccgccgccctcatcgagcgcgtgaagtag

DBGET integrated database retrieval system