KEGG   Cystobacter fuscus: CYFUS_007922Help
Entry
CYFUS_007922      CDS       T05065                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
Organism
cfus  Cystobacter fuscus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ATB42444
UniProt: A0A250JEV4
LinkDB All DBs
Position
complement(9917192..9919015)
Genome map
AA seq 607 aa AA seqDB search
MLGLSFALSGAFWMAKEVTVAEAVERLTGADGRIGFSFLSRNGNTEQTRLITFPDLAGQT
AARAGALQAMGLKQGERIAIILPENDEFVLTFLGAIRAGIIPVPIYPMHGLGQLDGYLEN
VRHIVRRSGAAAVVTNAKIKLLLGTVQSQCESVRNVISTEALADAAAPLQPRQVKLDDVA
FLQFTSGSTSSPKGVVVTHRNLAANIRCIMEEGFRVTPEDVGVSWLPLFHDMGLIGFLLA
PLFYQRPVTFIPPLTFLQRPVTWLESLSKYRATISCAPNFAFALAVKRIPEAQRQGLDLS
AWRIAGCGGEPIRPEVLRRFATAFAPQGFRAAALMPMYGMAESSLAIALGKPGAGLLSTP
VDHARMSEERIALPSGQPESALDIVACGKPFPGHELAIFDVADETSAFPLPDGHIGEIRI
AGPSVMKEYWGDPEATAQVFAGKYLRTGDLGFVLDGDLHVCGRLKEMIILNGRNYFPQDI
EHVATTVPGVRKGNLIAFGTHEASGTGEGAERIVLAVEIADPASFDPLAVIRTVQTALGI
ALHEVVVLQPGQLPKTSSGKLQRTKTRALYESGELHDRRSARETSVTDTLKQVVISQTSY
LKAVLFK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctcgggctgtcgttcgcgttgtcgggggcattctggatggccaaggaagtgactgtc
gcggaggcggtggagcgattgacgggcgccgatgggcgcattggcttctcgttcttgagc
cggaacggcaacacggagcagacccggctcatcacgttcccggatctggccgggcagact
gcggctcgtgctggcgcgctgcaggcgatgggtctgaagcagggtgaacggattgccatc
atcctcccggagaatgacgagttcgtcctcacgttcctgggagccatccgcgcgggaatc
atccccgtacccatctacccgatgcacggtcttggccagttggacggctatctcgagaac
gtgcggcacatcgtcaggcggagcggcgcggcggcggtggtgacgaacgcgaagatcaag
ctcctgctcggcacggtgcagagccagtgcgagagcgtgcgcaacgtcatctccaccgaa
gcgctcgcggacgccgccgcacccctgcaaccccggcaggtgaagctggacgacgtggcc
ttcctccagttcaccagcggctccacctccagccccaagggggtcgtcgtcacccaccgg
aacctggcggccaatatccgctgcatcatggaggagggctttcgggtgacgcccgaggac
gtgggagtctcctggcttcccctgttccatgacatggggctcattggtttcttgctggcc
ccgctcttctaccaacggcccgttacgttcatcccaccgctgaccttcctgcagcggccg
gtgacgtggctggagtctctcagcaaataccgcgcgaccatctcctgtgcgcccaacttc
gccttcgccctggccgtcaagcgcatcccggaggcgcaacggcaagggttggatctctcc
gcctggcgcatcgccgggtgtggcggcgagcccatccgcccggaggtcctgcggcgcttc
gccacggccttcgcaccccagggctttcgcgccgcggccctgatgcccatgtatggcatg
gccgagtcctcgctggccatcgcgctgggaaagccaggcgcggggctgctctcgacgccc
gtggaccatgcccgcatgagcgaggagcgcatcgccctcccgtccggtcagccggagagt
gcgttggacatcgtcgcgtgtggcaagcccttccctggccacgagctggccatcttcgac
gtggcggacgagaccagcgcgttccccctccccgatgggcacatcggggagatccgcatc
gccggccccagcgtcatgaaggagtattggggtgacccggaggcgacggcccaggtgttc
gccggcaagtatctgcgcacgggcgatctcggcttcgtcctcgacggtgacctccacgtc
tgcggccggctcaaggagatgatcatcctcaacggccgcaactacttcccgcaggacatc
gagcacgtggccaccacggtgccgggcgtgcgcaagggcaacctcatcgccttcggcacg
cacgaggcctctggcacgggcgagggagcggagcggatcgtcctggcggtggagatcgcc
gacccggcctcgttcgaccccctggcggtcatccggacggtacagaccgcgctgggcatc
gcgctccacgaagtggtggtgctccagcccgggcagctccccaagacgtccagcggcaag
ttgcagcgcaccaagacgcgtgcgctgtacgagagcggcgagttgcatgaccggcggagc
gcgcgagagacgagcgtgaccgacaccctcaagcaggtcgtcatcagccagaccagctat
ctgaaggctgtcctcttcaaataa

DBGET integrated database retrieval system