KEGG   Cystobacter fuscus: CYFUS_008590Help
Entry
CYFUS_008590      CDS       T05065                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYFUS_008590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfus02000]
    CYFUS_008590
Enzymes [BR:cfus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CYFUS_008590
Transporters [BR:cfus02000]
 Other Transporters
  Pores ion channels [TC:1]
   CYFUS_008590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: ATB43111
UniProt: A0A250JI89
LinkDB All DBs
Position
10701683..10702288
Genome map
AA seq 201 aa AA seqDB search
MSDEIVFYHNPRSRAQMVHWMLEELGGVPYRTVIIDMEKQEHKTPEFLAINPMGKLPTLV
HDGTVITETAAIITYLADTFPQAGLAPLPGDPRRGTYLRWLFFGAGCFEPALIDTMFKRP
PVERKGALGYGSYEETINALKKMLVPGPYILGEQFSAADVYVGAQLSWGAKFGAPGLDEP
IFKNYLERITSRLAYKITSGG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagatcgtcttctaccacaaccccaggtcgcgagcgcagatggtgcattgg
atgctcgaggaactcggtggcgtgccctatcggaccgtgatcatcgacatggagaagcag
gagcacaagacgccggagttcctcgccatcaatccgatgggcaagctgccgacgctcgtg
cacgacggcaccgtcatcaccgagacggccgcgatcatcacctacctcgccgacacgttc
ccccaggccgggctcgccccgctgcccggagacccgcgccgcggcacatatctgcgctgg
ctcttcttcggcgcgggctgtttcgagccggcgctgatcgacaccatgttcaagcgtccg
ccggtcgagcgcaaaggcgccctgggctacggcagctacgaggaaacgatcaacgcgctc
aagaagatgctcgtccccggcccctacatcctcggggagcagttcagcgcggccgacgtc
tacgtcggtgcccagctgagctggggcgcgaagttcggcgcacccggcctggacgagccc
atcttcaagaactacctcgaacgcatcacctcgcgcctggcctacaagatcacgtcgggc
ggctag

DBGET integrated database retrieval system