KEGG   Cystobacter fuscus: CYFUS_009033Help
Entry
CYFUS_009033      CDS       T05065                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00473  D-Alanine metabolism
cfus01100  Metabolic pathways
cfus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CYFUS_009033
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CYFUS_009033
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
    CYFUS_009033
Enzymes [BR:cfus01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CYFUS_009033
Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
 Precursor biosynthesis
  Racemase
   CYFUS_009033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATB43553
UniProt: A0A250JIU1
LinkDB All DBs
Position
11292262..11293467
Genome map
AA seq 401 aa AA seqDB search
MPHARLLLVLVAPLFLMNCRAHPGTPVPRAHDSNAWVEIDTKAFEHNLRTVKTRLSDKTQ
LCAVMKADAYGHGIDLLIPSIVSLGVPCVAIASNEDARHVREGGFGGRLVRIRTATPQEV
EDALPYTLEELVGNLAHAKHVSDIGQRHARTIPIHLDLNARGVGRNGLELSTARGKSDAL
ELLKLPHLQLTGIMTQLPVEDREDVLRGIALFKEEAAWIIEQGHLDRGKLLLHCANSFAT
LDVPESHLDMVRPGGAIYGETMATHPEFKQVMEVKTRVASVNAYPAGSTIGYDRTATLQR
DSLLANIPMGYADGYRRAFSNQGHVLIRGRRHPVVGRISMNTFMVDVTEAPDIQPGDEVV
LFGHQGTNAITQTELEQGAGTLIDELRMGWGRANPRVVKPE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatgctcgactgctgctcgtgctggtcgccccgctgttcctcatgaactgtcgg
gcgcatccgggaacacccgtcccccgtgcccacgactccaatgcctgggtggagatcgac
acgaaggccttcgagcacaacctccgcaccgtgaagacccggctgtcggacaagacccaa
ctctgcgcggtcatgaaagccgacgcctacgggcacggaatcgacctcctcattccatcg
atcgtgtccctgggtgtcccgtgcgtcgccatcgccagcaacgaggacgcccggcacgtg
cgtgaaggaggattcggcggaaggctggtccggatccggaccgcgacgccccaggaagtc
gaggacgcattgccctacacgctcgaggaactggtcggaaacctcgcgcacgcgaagcac
gtctcggacattggccagcggcatgcccggaccatccccatccacctcgatctcaacgcg
cggggcgtgggccgcaacggcctcgaattgagcacggcgcgaggcaagagcgacgcgctc
gaactgctgaagctcccccacctccaactcaccggaatcatgacccagttaccggtggag
gaccgcgaggatgtcctgcgcggaatcgctctcttcaaggaggaagcggcgtggattatc
gaacaggggcacctggaccgcggcaagctcctcctccattgcgccaactccttcgcgacc
ctggacgtcccggagagccatctcgacatggtccgtcccggaggcgccatctatggagag
accatggccacgcatccggagttcaaacaggtgatggaggtgaaaacccgcgtggcctcc
gtcaatgcctatccggctgggagtacgattggctatgaccgcacggccaccttgcagcgg
gactccctgctcgcgaacatccccatgggttacgccgatggctaccggcgcgccttctcg
aaccaggggcatgtcctcatccggggacgccgccatcccgtcgtcgggaggatctccatg
aacacgttcatggtcgatgtcacggaagctccggacatccaacccggtgacgaggtcgtg
ctgttcggccaccagggcaccaacgccatcacccagacggaactggagcagggggcgggc
acgctcatcgacgagctccgcatgggctggggcagggccaatccccgggtggtgaagccc
gagtag

DBGET integrated database retrieval system