KEGG   Cystobacter fuscus: CYFUS_009210Help
Entry
CYFUS_009210      CDS       T05065                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cfus  Cystobacter fuscus
Pathway
cfus00473  D-Alanine metabolism
cfus00550  Peptidoglycan biosynthesis
cfus01100  Metabolic pathways
cfus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CYFUS_009210
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYFUS_009210
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CYFUS_009210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
    CYFUS_009210
Enzymes [BR:cfus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CYFUS_009210
Peptidoglycan biosynthesis and degradation proteins [BR:cfus01011]
 Precursor biosynthesis
  Amino acid ligase
   CYFUS_009210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ATB43730
UniProt: A0A250JJC3
LinkDB All DBs
Position
11517141..11518124
Genome map
AA seq 327 aa AA seqDB search
MRLCTLYSSYEGSQSPYKDIDPAVDPSWWLPDHTWSRQPLTRANSREVLEQLAKEDFDAF
INLCDGAPDEDIAGVEVIQHLERLGLPFTGADSRFYAASREEHKQAWLNQGIGTPGHRFA
SDLATVEQAAGELRFPLLVKPSSGYASIGIEQDSRVGNREALLERAGRTLSRFGGVLLEE
FIEGREFTVLVSEPRPGEHVPWVHPPVEVHFPEGETFKHFDLKWMNYEAMNTRPVTDEGL
VERLGDIAQRTFLAVNARGYCRCDIRMDDAGHLFMLDCNANPGVFYPPDQPGSADFILSL
QPHGHRDFLLHIIECARRAHGVNTSGI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctgtaccttgtactcctcctatgaaggctcccagtccccctacaaggacatc
gatcccgccgtcgatccctcctggtggttgcccgaccacacctggtcccgccagcccctg
acacgcgccaactcgcgggaggtgctcgagcaactcgcgaaggaggacttcgacgcgttc
atcaacctctgtgacggagcaccggacgaggacatcgcgggcgtcgaggtcatccagcac
ctggaacggctgggattgcccttcacgggggcggactcgcgcttctacgcggcgtcacgc
gaagagcacaaacaggcctggttgaaccagggcatcggcacgccgggccatcgcttcgcc
tcggacctggccacggtcgagcaagccgctggggagctgcgcttccccctcctggtcaag
ccgagctccggttacgccagcatcgggatcgagcaggactcgcgggtcggcaaccgcgag
gcattgctcgagcgggccgggcggaccctctcccgcttcggcggcgtcctcctcgaggag
ttcatcgaggggcgagagttcaccgtgctcgtctccgagcctcgcccgggagagcacgtg
ccctgggtgcatcccccggtggaggtccactttccggaaggggagacgttcaagcacttc
gatctcaagtggatgaactacgaggccatgaacacccgccccgtgaccgatgaggggctc
gtggagcggctgggagacatcgcccagcggaccttcctggccgtgaatgcccgcggctat
tgccgctgcgacatccgcatggacgatgcgggccacctgttcatgctcgactgcaacgcg
aacccgggcgtgttctaccctccggaccagccgggaagcgccgacttcatcctgtcactc
caaccgcacgggcaccgggacttcctcctgcacatcatcgagtgtgcccggcgtgcgcac
ggggtgaacacgtctggcatttga

DBGET integrated database retrieval system