KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0327
Entry
CFVI03293_0327    CDS       T03000                                 

Gene name
argC
Definition
(GenBank) N-acetyl-gamma-glutamylphosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01210  2-Oxocarboxylic acid metabolism
cfv01230  Biosynthesis of amino acids
Module
cfv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CFVI03293_0327 (argC)
Enzymes [BR:cfv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     CFVI03293_0327 (argC)
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC DapB_N F420_oxidored Arc_PepC_II Rossmann-like GFO_IDH_MocA
Other DBs
NCBI-ProteinID: AHE93672
UniProt: W0D8V4
LinkDB
Position
297102..298130
AA seq 342 aa
MKISVGIIGISGYTGLELVKLLINHPNFELVYAGATSQNELEDLFPSLKNVLNLKVEVAD
TNEVKKRCKLVFLALPHTEGMKVVKELKGSDVKIVDLSADYRVSLENYEKNYCPHLDKSG
LKEAVYGLVEINRDLIKTANLIANPGCYPTCSLLALLPFVDMLEPKFGVMIDAKSGLSGA
GKSLKSTSHFVSVNENVNAYSPLTHRHSDEIKEHLNKNLKNGLKDDIEIMFVPHLVPLTR
GMLVSSFLLLKDEFKDIDPLQILRDFYKNEKFIRIRTEPVNTKFVSGTHFCDIFVINKNG
KLWINSSIDNLLRGASSQALANANLMFGFDESLGLPFVGNSI
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaaaataagcgtcggcataataggaatcagtggatataccggacttgaattagtaaag
cttttgataaatcatccaaattttgagctagtttatgcaggagcaactagccaaaatgag
cttgaagatctgtttccaagtcttaaaaacgtgctaaatttaaaagtcgaagtcgcagat
acaaatgaagtaaaaaagcgttgtaaacttgtatttttagcacttccgcatactgaaggt
atgaaggtagtaaaagagctaaaaggctcagacgtaaagatagttgatctttctgctgat
taccgcgtgagcttagaaaattatgaaaaaaattactgtccgcatttggataaaagcggg
ttaaaagaagccgtttatggactagtagagataaatagggacttgataaaaaccgcaaat
ttgatagcaaatccgggatgctatccgacttgttcgcttttagctttactaccgtttgta
gatatgctagagcctaaatttggtgtaatgatagacgcaaaaagtggtcttagcggtgct
ggaaaaagtctaaaatccactagccattttgtaagcgtaaatgaaaatgtaaatgcttat
agtcctcttactcataggcacagtgatgagataaaagagcatctaaacaaaaacctcaaa
aacgggttaaaagatgatatcgaaataatgttcgtgccgcatttagtgcctcttactcgc
ggaatgttagtgagtagttttttgcttcttaaagatgagtttaaagatattgatccacta
caaattttaagagatttttataaaaatgagaagtttatccgcattcgtaccgaaccagtt
aatacgaaatttgtaagcggaacgcatttttgcgatatttttgtgataaataaaaacggt
aaactctggataaactcaagtatcgacaatcttcttcgcggcgcttctagtcaagctttg
gcaaatgcaaatttgatgtttgggtttgatgagagtttaggacttccttttgtcggcaat
tctatatga

DBGET integrated database retrieval system