KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0784Help
Entry
CFVI03293_0784    CDS       T03000                                 

Gene name
argJ
Definition
(GenBank) bifunctional ornithine acetyltransferase / N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01130  Biosynthesis of antibiotics
cfv01210  2-Oxocarboxylic acid metabolism
cfv01230  Biosynthesis of amino acids
Module
cfv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CFVI03293_0784 (argJ)
Enzymes [BR:cfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     CFVI03293_0784 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     CFVI03293_0784 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AHE94101
UniProt: W0D786
LinkDB All DBs
Position
complement(810924..812111)
Genome map
AA seq 395 aa AA seqDB search
MFNLISLKNGLENVEGFYFGGVNAGFKTNGDNDLGFIRSDEPVMVSAIFTSNKFQAAPIK
HFKKYGKNFKTNFVLLNSKNANAMTGKAGIDDIDDIFKELGKKLNLINPIMSSTGVIGYR
LKKDKIIEAANKFDLISRNSDATAQAIMTTDSFKKEIAFRVELEDGKSFNIACICKGAGM
INPAFATMLCFILTDANIPQKDMDELLKSCVEESFNAISVDGDTSTNDTLMLLSSQKSGV
YDKDAFKFALETITKTMALNLVKDGEGSTKVVAFEVNGAKNYDEAQKAAKALSNSLLVKT
AIFGEDPNWGRIASTIGASGVECDEEKLIIYYDDVLVFDKNNPELDQEREIKAHNVMKKN
SYKISCFLGIADAKFTAYGCDLGHTYVKINADYRS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatcttataagcctgaaaaatggacttgagaatgttgaagggttttatttcggc
ggagtaaatgccggatttaagacaaacggagataatgatctaggcttcataagaagcgat
gagccggtaatggtttcagctatatttacttcaaacaaatttcaagcagctccgataaag
cattttaaaaaatacggtaaaaacttcaaaacaaactttgttttattaaattcaaaaaat
gcaaacgcaatgaccggaaaagccggtatagatgatatagatgatatatttaaagaactt
ggtaagaagctaaatttgataaatcctatcatgagttcaaccggagttatcggatatcgt
cttaaaaaagacaaaataatagaagccgcaaacaaatttgatcttatctcacgcaattct
gacgcaacagctcaagcgattatgacaacagatagctttaaaaaagagatagcttttaga
gttgaacttgaagatggcaaaagctttaacatagcttgtatctgcaaaggtgcaggtatg
ataaatccagcatttgcgacgatgttatgctttatcttaacagatgcaaatataccgcaa
aaagatatggatgaacttttaaaaagctgcgtagaagagagcttcaatgcgataagcgta
gatggcgacaccagcaccaatgatactttaatgcttttaagctcacaaaaaagcggagtt
tatgacaaagatgcttttaaatttgcacttgaaactatcacaaaaactatggctttaaat
ttagtaaaagatggggaaggaagtacaaaagtagtagcatttgaagtaaatggagcaaaa
aactatgatgaagcgcaaaaggcagcaaaggctttgtcgaattctcttttagtaaaaaca
gcaatttttggagaagatccaaactggggtagaatagcttcaaccataggagctagcggc
gtagaatgtgatgaagaaaagttaattatatattatgacgatgtgcttgtattcgacaaa
aataatcccgaattagatcaagaaagagagataaaagctcataatgttatgaaaaaaaac
agctataaaataagctgttttttgggtatagcagacgctaaatttacggcttacggatgc
gatttaggacacacgtatgttaaaataaacgcggattaccgttcataa

DBGET integrated database retrieval system