KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0807
Entry
CFVI03293_0807    CDS       T03000                                 

Gene name
purQ
Definition
(GenBank) phosphoribosylformylglycinamidine synthase PurLQS, glutaminase subunit PurQ
  KO
K23265  phosphoribosylformylglycinamidine synthase subunit PurQ / glutaminase [EC:6.3.5.3 3.5.1.2]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00230  Purine metabolism
cfv00250  Alanine, aspartate and glutamate metabolism
cfv00471  D-Glutamine and D-glutamate metabolism
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
Module
cfv_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CFVI03293_0807 (purQ)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFVI03293_0807 (purQ)
   00220 Arginine biosynthesis
    CFVI03293_0807 (purQ)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CFVI03293_0807 (purQ)
Enzymes [BR:cfv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CFVI03293_0807 (purQ)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     CFVI03293_0807 (purQ)
SSDB
Motif
Pfam: GATase_5 GATase_3 DJ-1_PfpI GATase SNO
Other DBs
NCBI-ProteinID: AHE94124
UniProt: W0D6K9
LinkDB
Position
complement(835201..835866)
AA seq 221 aa
MKVAIIHFPGTNCERDTQYAFDKLGCETKIIWHKETSVDTDLIILPGGFSYGDYLRTAAI
AKFSPIMNAVINHAKKGGLVLGICNGFQMLLETNLLDGAMRRNENMSFISKFHYLKIIST
NNKFLSNLNNGDIVDIPLAHGEGNYYADDDTIKRLYDNDQVLLKYCDKDGNIVNVNGSID
SIAGICNKNKNIFGLMPHPERAIESILGSEDGIKMLKGLIC
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaagtagctataatacattttccaggaacaaactgtgaaagagatactcagtacgct
tttgataaattaggctgtgaaactaaaattatatggcataaagaaactagcgtagatact
gatttgatcatacttcctggtggctttagctatggtgattatctaagaaccgctgctata
gctaagtttagtccgattatgaatgcggtaataaatcacgccaaaaaaggcggtcttgtg
cttggaatttgcaatggatttcaaatgcttttagaaacaaatcttttagatggagcaatg
agaagaaacgaaaatatgagctttataagcaaatttcattacttaaaaattatatcaact
aacaataaatttttatcaaatttaaataatggagacatagtagatatacctttagctcat
ggagagggaaactactacgctgatgatgatactataaaaagattatatgacaatgatcaa
gtattactaaaatactgtgataaagatggcaatattgtaaatgtaaatggctcaattgac
tccatagcaggaatttgcaataaaaataaaaatatatttggactaatgcctcatcctgaa
cgcgctatagaaagtattctaggaagcgaggacggtataaaaatgctaaaaggtttgatt
tgctaa

DBGET integrated database retrieval system