KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0829
Entry
CFVI03293_0829    CDS       T03000                                 

Gene name
argD
Definition
(GenBank) N-succinyldiaminopimelate-aminotransferase / acetylornithine transaminase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00300  Lysine biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01120  Microbial metabolism in diverse environments
cfv01210  2-Oxocarboxylic acid metabolism
cfv01230  Biosynthesis of amino acids
Module
cfv_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
cfv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CFVI03293_0829 (argD)
   00220 Arginine biosynthesis
    CFVI03293_0829 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfv01007]
    CFVI03293_0829 (argD)
Enzymes [BR:cfv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     CFVI03293_0829 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     CFVI03293_0829 (argD)
Amino acid related enzymes [BR:cfv01007]
 Aminotransferase (transaminase)
  Class III
   CFVI03293_0829 (argD)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase Aminotran_1_2 Cas_DxTHG
Other DBs
NCBI-ProteinID: AHE94144
UniProt: W0D6N4
LinkDB
Position
858171..859334
AA seq 387 aa
MLMGNYARVDLGFKKGKGAILWSLDGKDYVDFGSGIGVCSLGHSNKKLAKTIKNQAKTLL
HTSNIYKIKPQEKLADKMCDLLGEPYYLFFANSGAEANECAIKLARKYGNSFEEKKYEII
TLGNSFHGRTIATLKLTGQEKFHSKDFAPYPDAFKFFNTIDEIIENLNDKTVAVMVELVQ
GEGGINPLNIAEIQKLAQILKERNILFITDEVQCGVYRTGEFVTSQIYGVTPDIITFAKG
LGGGVSIGACASKKDIFKAGDHGSTFGGNFLAMSAGITVLKEMKKLKKSGKLDEAIKEFK
NNLDELVSNYSDVFRSRVGLGLMQGLILKNPENLASVFNKALEKRVLVLKSGKDTLRFLP
PLNISKKEIKKGFKRLKNALNELNLER
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgttgatgggaaattatgctagagttgatttaggatttaaaaaaggtaagggcgctatt
ttatggagtcttgacggaaaagattatgtagattttggaagtggtattggggtatgttcg
cttggtcatagtaataaaaaattagcaaaaactataaaaaatcaagcaaaaacacttctg
catacttcaaatatatataaaataaaacctcaagaaaagcttgctgataagatgtgcgat
ctacttggagagccgtactatctattttttgcaaattccggagctgaagcaaacgagtgt
gctataaaattagctagaaagtacggaaattcatttgaagagaagaaatacgaaatcata
actcttggcaactcatttcacggcagaacaattgctacgctcaagcttaccggacaagaa
aaatttcattcaaaggatttcgctccgtatccagatgcttttaaattttttaatactata
gatgaaattatagaaaatcttaatgataaaacagttgctgttatggtcgagcttgtgcaa
ggcgagggcggtataaatcctctaaatatagccgaaatacaaaaattagctcaaatttta
aaagagcgaaatatactatttatcacagatgaagttcaatgcggagtatatagaactggt
gagtttgtaactagtcaaatttatggtgtaactccagatatcataacttttgcaaaaggt
cttggaggcggcgttagtataggagcgtgcgctagtaaaaaagatatttttaaagccgga
gatcatggaagtacgtttggtggaaattttttagcgatgagcgccgggatcaccgtttta
aaagagatgaaaaaacttaaaaaaagcggaaaattagacgaagccataaaagagttcaaa
aataatttagatgagcttgttagcaactatagcgatgtttttagaagcagagtaggacta
ggtcttatgcaaggacttatattaaaaaatcctgaaaatttagcatcagtgttcaataaa
gccttagaaaaaagggttcttgtgctaaaatccggtaaagatacattgaggtttttaccg
cctttaaatatcagtaaaaaagagataaaaaaaggttttaaaagattaaaaaatgcctta
aacgaactaaatttggaaagataa

DBGET integrated database retrieval system