KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0855
Entry
CFVI03293_0855    CDS       T03000                                 

Gene name
aspB
Definition
(GenBank) aspartate aminotransferase, aminotransferase, classes I and II
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00250  Alanine, aspartate and glutamate metabolism
cfv00270  Cysteine and methionine metabolism
cfv00330  Arginine and proline metabolism
cfv00350  Tyrosine metabolism
cfv00360  Phenylalanine metabolism
cfv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfv00401  Novobiocin biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01210  2-Oxocarboxylic acid metabolism
cfv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFVI03293_0855 (aspB)
   00270 Cysteine and methionine metabolism
    CFVI03293_0855 (aspB)
   00220 Arginine biosynthesis
    CFVI03293_0855 (aspB)
   00330 Arginine and proline metabolism
    CFVI03293_0855 (aspB)
   00350 Tyrosine metabolism
    CFVI03293_0855 (aspB)
   00360 Phenylalanine metabolism
    CFVI03293_0855 (aspB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFVI03293_0855 (aspB)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CFVI03293_0855 (aspB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfv01007]
    CFVI03293_0855 (aspB)
Enzymes [BR:cfv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     CFVI03293_0855 (aspB)
Amino acid related enzymes [BR:cfv01007]
 Aminotransferase (transaminase)
  Class I
   CFVI03293_0855 (aspB)
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_5
Other DBs
NCBI-ProteinID: AHE94169
UniProt: W0D6S0
LinkDB
Position
complement(883662..884831)
AA seq 389 aa
MLSKKIGVLSESLTIAISSKAKEMKANGQDVISFSAGEPDFDTPNVIKEAVKRALDSGCG
KYTPVPGRPEVLKAIATKLKRDNNLEYKTNQIVTNVGAKHSLFNIFQCIIDDGDEVIMAS
PYWVSYPEIVKFSGGKPVIIETDESSKFKLTSEALKKAITPKTKAIVLNSPSNPCGGVYT
KAELQAIAKVLEGTDIIVLSDEIYEKLTFNGEFVATARISPDMFKRTITINGLSKCGAMP
GWRFGYMASVIDDLVAAVKKLQSQSTSNISSLVQDGAIPALLGEADKDIEFMRSKFIERR
DYAVAALNAIKGLNVVKPDGAFYLFVSCKDIESDSVKFCKDMLENALVATVPGVGFGMDG
YFRLSFACDMDSIKKGIDRIAKFVESYKK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgttatctaagaagattggagtactttcagagagcctaaccatagctattagctcaaaa
gcaaaagagatgaaggcaaacgggcaagatgtcataagttttagcgcaggcgaacctgac
tttgataccccaaatgttataaaagaagccgtaaaaagagcattagactctggttgtgga
aaatatactccggtgccaggacgccctgaagtattaaaagctatagctacaaagctaaaa
agagacaacaacttagagtacaaaacaaatcaaattgttacaaacgtaggagcaaaacac
tctttgttcaatatctttcagtgcattatagatgatggagatgaagttataatggcttct
ccatactgggtaagctatcctgagatagttaaatttagcggcggaaaaccagttataata
gaaactgatgaaagcagtaaatttaaactcacaagcgaagctttaaaaaaagctatcact
ccaaaaacaaaagctatcgtactaaacagtcctagcaatccatgcggcggcgtttataca
aaagctgagcttcaagctatagcgaaagttttagaaggtacagatatcattgttttaagc
gatgaaatttatgaaaagcttacatttaacggtgagttcgtagccacagctaggataagt
cccgatatgtttaaacgtactataactataaacggtcttagcaagtgcggagcgatgccg
ggctggagatttggatatatggctagcgttatagatgatcttgttgcagcagttaaaaaa
ttacaaagccaaagcactagtaatatctctagtctcgttcaagacggagccatacctgct
ttgcttggtgaagcagataaagatatagagtttatgcgatctaaatttatagaaagacgc
gactacgcagtagctgcattaaacgctataaaaggacttaacgtcgtaaaaccagacggt
gcattttatctattcgtaagttgtaaagatatcgagtctgactctgtgaaattttgtaaa
gatatgctagaaaacgcacttgtagccactgttcctggcgtgggattcggtatggatgga
tactttagattaagttttgcttgcgatatggatagcataaaaaaagggatcgacagaata
gctaaatttgtagaaagctataaaaaatag

DBGET integrated database retrieval system