KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_0907
Entry
CFVI03293_0907    CDS       T03000                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00250  Alanine, aspartate and glutamate metabolism
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01230  Biosynthesis of amino acids
Module
cfv_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFVI03293_0907 (argG)
   00220 Arginine biosynthesis
    CFVI03293_0907 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfv04147]
    CFVI03293_0907 (argG)
Enzymes [BR:cfv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     CFVI03293_0907 (argG)
Exosome [BR:cfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFVI03293_0907 (argG)
SSDB
Motif
Pfam: Arginosuc_synth QueC Asn_synthase
Other DBs
NCBI-ProteinID: AHE94219
UniProt: W0D6W9
LinkDB
Position
complement(937442..938665)
AA seq 407 aa
MQKKDVKKVVLAYSGGLDTSIILKWLQDEYKCEVVTFTADIGQGEEVEPARKKAISLGIK
PENIFIEDLREEFVKDFVFPMFRANAIYEGEYLLGTSIARPLIAKRLVEIAAATKADCVS
HGATGKGNDQVRFEIGAYALNPNIKVIAPWREWDLNSREKLLAYAEKNGIDISKKKGKSP
YSMDANLLHISYEGLVLEDPNHAPEEDMWRWSVSPKNAPDESDIIEIEYKNGDPVAINAK
SMKPHEILTELNRLGAKHGIGRLDIVENRYVGMKSRGCYETPGGTIMLKAHRAIESITMD
REAAHLKDELMPKYASLVYNGYWFSPERKMLQAAIDESQKNVNGTVRVELYKGNVMVIGR
DSKTDNLFNEAYCTFEEDSVYDQKDANGFIKLNALRFIIAGKNGRKF
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcaaaagaaggatgttaaaaaagttgttttggcttatagtggcggacttgatacaagt
atcattttaaaatggctacaagacgagtataaatgtgaagtcgtgactttcacagccgat
atcggtcaaggagaagaggtcgagccagctcgcaaaaaagctataagcttaggtataaaa
cctgaaaatatctttatagaggatttgcgtgaagagtttgtaaaagacttcgtatttcct
atgtttagagcaaatgctatatacgagggcgaatatcttttaggcacatctatcgctcgt
cctcttatagcaaaacgtcttgttgagatagctgctgccacaaaagcagactgcgtaagt
catggtgctactggtaaaggaaatgatcaagttcgttttgagataggagcttacgcctta
aatccaaatatcaaagttatcgctccttggagagagtgggatctaaatagccgtgaaaaa
cttctagcatatgcagagaaaaatgggatagatataagcaagaaaaaaggtaaatctcca
tattctatggacgcgaatttacttcatatctcttatgaaggacttgttttagaagatcca
aatcacgccccagaagaagatatgtggagatggagcgtcagtccaaaaaatgctcctgat
gagagcgatattatcgaaatagagtataaaaacggcgatcctgttgcgataaatgctaaa
tcaatgaagcctcacgagatcttaacagagctaaacagacttggtgcaaaacatgggatt
gggcgccttgatatcgtagaaaaccgctatgtgggtatgaaaagtaggggttgctatgaa
actccaggaggcactataatgctaaaagctcacagagctatagagagcattactatggat
agagaagcagcacatctaaaagacgaacttatgccaaaatacgctagtttagtatataac
ggatactggttttcgcctgagcgtaaaatgcttcaagctgcgatagacgagagccaaaag
aatgtgaatggtactgttagagtcgagctttataaaggcaatgttatggtcatcggtaga
gatagcaagaccgataatctatttaacgaagcttactgcacgtttgaagaagatagtgtt
tatgaccaaaaagacgcgaacggatttataaaacttaacgctttacgctttataatcgcc
ggaaaaaacggaagaaaattttag

DBGET integrated database retrieval system