KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1010
Entry
CFVI03293_1010    CDS       T03000                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00250  Alanine, aspartate and glutamate metabolism
cfv00630  Glyoxylate and dicarboxylate metabolism
cfv00910  Nitrogen metabolism
cfv01100  Metabolic pathways
cfv01120  Microbial metabolism in diverse environments
cfv01230  Biosynthesis of amino acids
cfv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFVI03293_1010 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CFVI03293_1010 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFVI03293_1010 (glnA)
   00220 Arginine biosynthesis
    CFVI03293_1010 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFVI03293_1010 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfv04147]
    CFVI03293_1010 (glnA)
Enzymes [BR:cfv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     CFVI03293_1010 (glnA)
Exosome [BR:cfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFVI03293_1010 (glnA)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N Cyclophil_like2
Other DBs
NCBI-ProteinID: AHE94319
UniProt: W0D747
LinkDB
Position
1035627..1037054
AA seq 475 aa
MGKFVNNVKEFFEFCKENEVKFVDFRFTDLKGTWHHVSYNIKAINEDSFNGLPFDGSSID
AWQPIHKSDMMLKPDVETAFLDPFTADTTIIVICDVYDIYKGELYEKCPRSIAKKASQYL
RDSGVGDVAYFGPENEFFVFDNVRIIDKPNCAMYEVDTEEGEWNDGKEYTDGYNTGHRPR
TKGGYFPVQPVDSMVDLRAEMVNVLEQVGLETFVVHHEVAQGQGEIGVKFGTLVEAADNV
QIYKYVVKMVAHLNGKTATFMPKPLYGDNGSGMHVHQSIWKDGKNLFYKDGNYANLSDIA
RWYIGGVLKHARSVAAFTNPSTNSYKRLIPGFEAPSILTYSCQNRSASCRIPYGSGEKSV
RAEFRFPDSTACPYLAFAAMLLAGLDGIKNKVEPVGPMDEDLFELTLDEIRDRGIEQLPH
TLRGSLEAVIRDNKYLSPAMSNLFIETYQHYKFETQVWPYEQRPTPFEFKTSFSC
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgggcaaatttgtaaataacgtaaaagaattttttgagttctgcaaggaaaatgaagtc
aaatttgtggattttcgtttcacggacttaaaaggtacttggcatcacgtatcgtataat
ataaaagcgattaatgaagattcattcaacggacttccgtttgatggtagttctatagac
gcttggcagccgattcataaatcagatatgatgctaaaaccagatgtagaaactgcgttt
ttagatccttttactgcagatacgactattatagtaatatgtgatgtttatgacatatac
aaaggtgaattatatgaaaaatgtcctagaagtatagcaaaaaaggcatcgcaatatcta
agagatagcggtgtaggagacgtagcttactttggacctgaaaatgagttttttgtattt
gacaatgttcgcattatagataaaccaaattgcgctatgtatgaagtagatacggaagaa
ggcgagtggaatgatggtaaagagtatacagatggatacaatacgggtcacagaccacgc
accaaaggtggatattttccagttcaaccagtcgatagcatggtggatctaagagctgaa
atggtaaatgtacttgaacaagtaggacttgaaacttttgtggttcatcatgaagttgct
caaggacaaggcgaaataggcgtcaaattcggcacacttgtagaggctgcggataatgtt
caaatttataaatatgtagtaaaaatggtagctcatctaaacggtaaaacagctacattt
atgccaaaaccgctttatggagataacggaagcggtatgcacgtacatcaatctatctgg
aaagacggtaaaaatttattttataaagatggaaattatgcaaatcttagcgatatcgca
aggtggtatataggtggtgttttaaaacacgcaagaagcgtggctgcatttacaaaccct
agtacaaatagttataaaagattaattccgggttttgaagctcctagcattttaacttat
tcttgccaaaacagaagcgctagttgtcgtattccttatggttcaggagagaaaagcgtt
agagcggagtttagatttccagatagcacggcttgcccatatttagcgtttgccgctatg
cttctagcagggcttgatggtataaaaaataaagtggaacctgtcggtcctatggatgaa
gatttgtttgagctaactcttgatgagataagagatcgaggtatagagcaacttcctcac
actttaagaggcagccttgaagcagttatccgtgataataaatatctaagtcccgcaatg
agcaatttatttatagaaacatatcaacattataaatttgaaactcaagtatggccttat
gagcaaagacctactccgtttgagtttaaaacttcattttcttgttag

DBGET integrated database retrieval system