KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1035
Entry
CFVI03293_1035    CDS       T03000                                 

Gene name
argB
Definition
(GenBank) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01210  2-Oxocarboxylic acid metabolism
cfv01230  Biosynthesis of amino acids
Module
cfv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CFVI03293_1035 (argB)
Enzymes [BR:cfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     CFVI03293_1035 (argB)
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-ProteinID: AHE94343
UniProt: W0DB15
LinkDB
Position
1061648..1062490
AA seq 280 aa
MLKSIRTAEIILSALPYIQKFRDEIFVIKYGGAAQIDEKLKNNFARDIVLLQLVGIKAVI
VHGGGKKINSFLERLNLKSEFIDGLRVTDKDAMEVVEMTLSGLINKEITSLLNKHGARAI
GISGKDDNMLKAKSLDDGKYGFVGEITDVNENVILTIINDGLIPVIAPIAIGSEYETYNI
NADLCASAIASKLKARKVIFLSDIKGVLDKDEKLISKLNETSINELKNNGAISGGMIPKI
DACLECIKSGVGAAHIIDGKIPHSLLLEIFTDEGIGSVIK
NT seq 843 nt   +upstreamnt  +downstreamnt
gtgttaaaaagcataagaacagctgagataatattaagtgccctgccttatattcagaaa
tttagagatgaaatttttgtcataaaatacggcggcgcagctcaaatagatgaaaaattg
aaaaataattttgcaagagatattgtgcttttacaactagtaggcattaaagccgtcatt
gtacatggaggcggaaaaaagataaattcatttttagaaagactaaatttgaaaagtgaa
tttatagacggcttaagagtcacggataaagatgctatggaagtagtagaaatgaccttg
agcggacttataaataaagaaataacaagtcttttaaacaaacacggcgcaagggctatc
ggcataagcggcaaagacgataatatgttaaaggcaaaaagcttagatgatggaaaatac
ggatttgtaggagagataacagacgtcaatgaaaatgttatattaaccataataaacgat
ggactcataccagtcatcgcccctatagctataggaagcgagtatgaaacatataacata
aacgcagatctttgcgcaagtgctattgctagcaaattaaaagctagaaaagttatattt
ttaagtgatatcaagggggttttagacaaggatgaaaaacttatcagcaagttaaacgaa
acttctataaatgagttgaaaaataacggagcaatcagcggtggaatgataccgaagata
gacgcgtgtttagaatgtataaaaagcggagttggtgcagcacacataatagatggaaaa
attcctcactctttgctgcttgaaatatttacagatgaaggtatagggagcgttataaaa
tga

DBGET integrated database retrieval system