KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1345
Entry
CFVI03293_1345    CDS       T03000                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00250  Alanine, aspartate and glutamate metabolism
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01230  Biosynthesis of amino acids
Module
cfv_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFVI03293_1345 (argH)
   00220 Arginine biosynthesis
    CFVI03293_1345 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfv04147]
    CFVI03293_1345 (argH)
Enzymes [BR:cfv01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     CFVI03293_1345 (argH)
Exosome [BR:cfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFVI03293_1345 (argH)
SSDB
Motif
Pfam: Lyase_1 ASL_C2 Guanylate_kin
Other DBs
NCBI-ProteinID: AHE94641
UniProt: W0D8S4
LinkDB
Position
1346444..1347832
AA seq 462 aa
MQKMWEGRFSESSSELLEAFNASIEFDKELYKQDIEGSIAHAKMLGKCGILTTEQSQKII
NGLQQVKSEIDNSEFEFKIENEDIHMAVEKRLSEIIGKELGGKLHTARSRNDQVALDFKL
FVQQQSVIISNLILELMVVLKDIAAEHKNTLMPGFTHLQHAQPISLAYHLLAYAFMFKRD
YERLICCYQRNDLSPLGSCALAGTPHPINRKMVAEELGFKDITQNGMDSVSDRDFALELL
FNISLIFTHTSRLCEELILWSSSEFRYITISDKFSTGSSIMPQKKNPDVAELIRGKTGRV
YGNLISLLTVMKALPLAYNKDMQEDKECVFDSVKTAINSLIILKEMLKTTTFNKDFMLKA
CKNGHLSATDLADYLVRNLDIPFREAHFITGKCVALAEKLGKDISELSLDELKSIHQDIK
SDALEVLKLENSKEARQSEGGTGNKSVDTQLNELNSFLNLKR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcaaaaaatgtgggaaggtcgatttagtgagagtagcagcgaacttttagaagctttt
aacgcctcaatagaatttgataaagagttgtataaacaagatatagagggctcaatagct
cacgccaaaatgttgggaaaatgcggaattttaaccacagaacaatcgcaaaaaattata
aacggactgcaacaagtaaaaagcgaaatagacaactctgagtttgaatttaaaatagaa
aatgaagatatacatatggcagttgaaaagcgactatccgagattataggcaaagagctt
ggcggtaagcttcacacagcaagaagtagaaacgatcaagtagctcttgattttaaactt
tttgtgcaacaacaaagcgttataatttcaaatttaatattagaattaatggtggtttta
aaagatatcgctgctgagcataaaaatacgttaatgcctggttttacacatcttcaacac
gcacaaccaattagccttgcatatcatttattagcgtatgcttttatgtttaaaagagat
tatgaaaggttgatttgctgctaccaaagaaacgacttaagtccacttggatcatgcgca
cttgccggaactcctcatcccataaatcgaaaaatggtagctgaagaactcggatttaaa
gatatcacgcaaaacggtatggatagtgttagcgatagagattttgcgcttgaacttctt
tttaatataagccttatatttactcatacatcaagactttgtgaagagcttatactatgg
agtagcagtgagtttagatacattactataagtgataaatttagtaccggctcaagcata
atgccgcaaaagaaaaatccggatgttgccgagcttataagaggaaaaacaggtagagta
tacggcaacctcatttcacttttaacagttatgaaagctcttccgcttgcttataataaa
gatatgcaagaagacaaagaatgcgtatttgatagtgttaaaactgcgatcaactctctt
attatacttaaagagatgttaaaaacgactactttcaataaagattttatgttaaaagct
tgtaaaaacggtcaccttagcgctactgatttggcggattatttagtaaggaatttagat
ataccatttagagaagctcattttatcaccgggaaatgcgtggcattagctgaaaaactt
ggtaaagatataagcgagctcagcttagatgagctaaaaagtatccaccaagatatcaaa
agtgacgctttagaagtgttaaaattagaaaactcaaaagaagctagacaatctgagggc
ggcaccggcaataaaagtgtcgatacgcaattaaacgaactaaattcgtttttaaattta
aaaagatag

DBGET integrated database retrieval system