KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1588
Entry
CFVI03293_1588    CDS       T03000                                 

Gene name
gdhA
Definition
(GenBank) glutamate dehydrogenase
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv00250  Alanine, aspartate and glutamate metabolism
cfv00910  Nitrogen metabolism
cfv01100  Metabolic pathways
cfv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CFVI03293_1588 (gdhA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFVI03293_1588 (gdhA)
   00220 Arginine biosynthesis
    CFVI03293_1588 (gdhA)
Enzymes [BR:cfv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     CFVI03293_1588 (gdhA)
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N NAD_binding_7 FTCD_C
Other DBs
NCBI-ProteinID: AHE94865
UniProt: W0DD23
LinkDB
Position
complement(1586165..1587529)
AA seq 454 aa
MGVHEYINHTVEHIKKTSPGQNTFLQAATEVLHSLEPLLSAEDKYLKHKIIDRIVMPERT
TMFRVTYMNDKNEPCSHFGYRVEFNSALGPYKGGLRFHPSVCLDIIKFLGFEQILKNSLT
GLNMGGGKGGANFDPKGKSDGEIMRFCQSFMNELYKLIGDVKDVPAGDIGVGGREIGYMF
GQYKKLTNRFDGALTGKGLSWGGSLARTEATGYGSVYFANEMLKKSGGSLEGKKCSVSGA
GNVAIYTVEKLYEFGALPITVSDSTGFVYDKDGIDTQLLKRLKEVERKGLSDYTDFRKNA
VFTPVKAYKEGTNGVWSVPCDAAFPSATQNELHLVDIKTLYNNGCRLVCEGANMPSTLDA
IDFMISKKDFLFGPAKAANAGGVATSGLEMAQNASMQKWSFEEVDKKLHDIMRNIFNESY
DTSVEFGDAGNLVLGANIAGFRKVADAMIDQGYV
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgggagtgcacgaatacatcaatcacacagttgaacacatcaaaaaaacaagtccgggg
caaaatacgtttttacaagccgcgaccgaagttttacatagtcttgaacctcttcttagc
gcagaagataagtatctaaaacataaaatcatagatcgtatcgtaatgccggagagaaca
acgatgtttagagtaacttatatgaatgataagaatgagccgtgttctcactttggttat
cgtgttgaattcaactcagctcttggaccttataaaggtggtttaagatttcatccatca
gtttgcttagatataattaaatttcttggttttgagcaaattttgaaaaattcgcttact
gggcttaatatgggcggaggaaaaggcggagctaatttcgatccaaaagggaaaagcgac
ggcgaaataatgaggttttgtcaatcgtttatgaatgaactttataagctaataggcgac
gtaaaagacgtacctgctggcgatatcggagtaggcggtcgcgagatcggatatatgttt
ggtcaatataaaaaattaacaaatcgatttgatggagcccttactggcaaaggtttgagc
tggggcggaagccttgctagaacagaagctactggatacggttctgtttattttgcgaat
gaaatgttaaaaaaatcaggcggttctttagaaggtaaaaaatgctcagttagcggagca
ggaaatgttgctatatatactgtagaaaagctgtatgaatttggagcgcttcctattact
gtcagtgattcaaccggatttgtttacgacaaagatggaatcgatactcagcttttaaaa
cgcttaaaagaggtagagagaaaaggtcttagcgactatactgattttagaaaaaatgcg
gtatttactccagtgaaagcatataaagaaggtacaaacggtgtttggagcgtaccttgc
gacgcagcttttcctagtgctactcaaaacgaacttcatttggtggatataaaaactctt
tataataacggttgtcgcttggtttgcgagggtgcaaatatgcctagcactcttgatgct
atagattttatgattagcaaaaaagactttttattcggtcctgctaaagcggcgaacgca
ggtggcgttgctactagcggtttagagatggctcaaaatgcaagtatgcaaaaatggagt
tttgaagaggtcgataaaaaactacatgatataatgagaaatatatttaatgagagttac
gatacatcagtagagttcggagatgccggaaaccttgttcttggagcaaatatagcagga
tttagaaaagttgctgacgctatgatagatcaaggatatgtttaa

DBGET integrated database retrieval system