KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1592Help
Entry
CFVI03293_1592    CDS       T03000                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR Fe_dep_repress HTH_IclR HTH_29 HTH_38 HTH_Crp_2 TrmB SMC_ScpB HTH_24 Penicillinase_R HTH_23 Topoisom_bac HTH_27
Motif
Other DBs
NCBI-ProteinID: AHE94869
UniProt: W0D8R6
LinkDB All DBs
Position
complement(1590852..1591283)
Genome map
AA seq 143 aa AA seqDB search
MVNYLGACLFFSSQAFSRISEEIAKEYFMPTTLSPSHAYLLHAIVLSEGISPSKLASIMC
LSPSTVTRLVDKLVYRGLVEREFIGKTSNLKATKSGVELKDIIEQSMQKLNSKFIEIFGE
QKIESLNLYFKEFILKLNSKENL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggtaaattatctcggtgcttgtctgttttttagctctcaagccttttcaagaatttct
gaagagattgcaaaagagtattttatgccgacaactctttcgccatctcacgcttatttg
ctgcatgctatagttcttagcgaaggcataagtcctagcaagttggctagtataatgtgt
ttgtctccatctaccgtaacaagacttgttgataaactagtttatagaggtcttgttgag
cgtgaatttataggaaaaacttcgaatttaaaagctacaaaaagcggagtggagttaaaa
gatattatagaacaatctatgcaaaaattaaattctaaatttatagaaatttttggcgaa
cagaaaatagagagtttaaatttatattttaaagagtttattttaaaattaaattcaaaa
gaaaatttataa

DBGET integrated database retrieval system