KEGG   Campylobacter fetus subsp. venerealis cfvi03/293: CFVI03293_1604
Entry
CFVI03293_1604    CDS       T03000                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cfv  Campylobacter fetus subsp. venerealis cfvi03/293
Pathway
cfv00220  Arginine biosynthesis
cfv01100  Metabolic pathways
cfv01110  Biosynthesis of secondary metabolites
cfv01230  Biosynthesis of amino acids
Module
cfv_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CFVI03293_1604 (argF)
Enzymes [BR:cfv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CFVI03293_1604 (argF)
SSDB
Motif
Pfam: OTCace OTCace_N Glyco_hydro_4
Other DBs
NCBI-ProteinID: AHE94881
UniProt: W0D9G5
LinkDB
Position
complement(1602217..1603146)
AA seq 309 aa
MRHFLTLNDLDKNEILDILSLAKDIKKEAKSRNYISYLKDQTLAMIFEKSSTRTRVSFEV
GIHQLGGKGLFLSSRDIQLGRGEPVKDTARVLGRMVDMIMARVYKQSDLEELAKFSGVPV
INGLSDDFHPVQLMSDLLTLSELGLNLQTMKVAYVGDGNNMTNSWLMAASKLGFELRVAT
PKGYEVPQWVLDIAKQNSKISCANLIITDNPKAAISGADVVTTDTWVSMGQEDEKEKRIN
DFAGYCVDDDMMSLAAKDAKFLHCLPAYRGYEVSEAVFEAHAGEIFSEAENRLHAQKAVM
VWCDRKRYE
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagacattttttgacacttaacgacttagataaaaatgaaatcttagatattttaagt
ttagcaaaagatataaaaaaagaggcaaaaagtagaaattatatctcatatctcaaagac
caaactttagccatgatatttgaaaaaagctcgacaaggacgagagttagctttgaagta
ggcattcatcaattaggcggcaaaggattatttctaagcagtcgcgatatacagttaggg
cgcggagaacctgtcaaagatacggctagagttcttgggagaatggtagatatgataatg
gctagagtttataagcaaagcgatctcgaagaacttgctaaatttagcggagtgcctgtt
ataaacggtcttagcgatgattttcatcctgttcagcttatgtctgatctgcttacttta
agcgagcttggattaaatttacaaactatgaaagtagcgtatgtgggagatggaaataat
atgaccaactcatggctcatggctgcatctaagcttggatttgagcttagagtagcaact
ccaaaaggctatgaagtgccacagtgggttttagacatcgctaaacaaaactccaaaata
agctgtgcgaatttgattatcacagataatcctaaagcagcaattagcggcgcagacgtc
gtcacgaccgatacttgggtctctatgggacaagaggatgaaaaagaaaagcgcattaat
gattttgcaggatactgcgttgatgatgatatgatgagcttagcggccaaagatgctaaa
tttttacactgtttgcctgcttaccgcggatatgaagttagtgaagcggttttcgaagct
cacgcgggggaaatttttagcgaggctgaaaaccgtttgcacgcccaaaaagctgttatg
gtctggtgtgataggaagagatatgaataa

DBGET integrated database retrieval system